Viking Pattern Blue (Inside (Left))Viking Pattern Blue (Inside (Right))Viking Pattern Blue (Back)
Viking Pattern Blue (Front)
Sale Price $3.94.  
Original Price $4.63 Comp. value
per card
You save 15%

Viking Pattern Blue

4.9 out of 5 stars rating
7329 Total Reviews
| by ArtYourself
View Product Details

Popular from this Department

About Cards

Sold by

Size: Standard (5" x 7")

Birthdays or holidays, good days or hard days, Zazzle’s customized greeting cards are the perfect way to convey your wishes on any occasion. Add a photo or pick a design and brighten someone’s day with a simple “hi”!

  • Dimensions: 5" x 7" (portrait) or 7" x 5" (landscape)
  • Full color CMYK print process
  • All-sided printing for no additional cost
  • Printable area on the back of the card is 3" x 4" (portrait) or 4" x 3" (landscape)
  • Standard white envelopes included

Paper Type: Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Viking Pattern Blue

Viking Pattern Blue

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating7.3K Total Reviews
6714 total 5-star reviews485 total 4-star reviews70 total 3-star reviews27 total 2-star reviews33 total 1-star reviews
7,329 Reviews
Reviews for similar products
5 out of 5 stars rating
By K N.November 10, 2018Verified Purchase
Folded Card, Size: Standard (5" x 7"), Paper: Signature Matte
Creator Review
What strikes me most about this card on opening the envelope is the stunning color and the beautiful close up. The card itself lends it to a feel good touch as well so its a lot of senses perked! My customers like it as well! The color is stunning! The closeup is very nicely detailed and just perfectly awesome! Could not ask for better printing!
5 out of 5 stars rating
By NavinJOSHI s.August 13, 2013Verified Purchase
Folded Card, Size: Standard (5" x 7"), Paper: Signature Matte
Creator Review
Unusual color scheme is clearly visible on the art. Not many artist try to emphasize that as an artist they can see things different so long they look beautiful. This is an UNIQUE image. I bought a bunch of 34 different cards as like to give a different card to each of my friend which makes it very personal. When friends talk with each other, they appreciate the gesture all the more. Also I took advantage of volume pricing. Thanks to Zazzle for allowing to order even one card. I recommend people to buy from Zazzle. Pure Joy. Excellent printing and color tones.
5 out of 5 stars rating
By K N.November 10, 2018Verified Purchase
Folded Card, Size: Standard (5" x 7"), Paper: Signature Matte
Creator Review
iI am overjoyed and tickled pin with this card!! he minute I oened the envelope and saw it it just raised my spirits! Love the feel of the paper, its high quality all the way! And my customer really appreciaed it!! And topping that paired up with the labels was a perfect match! The color and the entire card and design is perfect! Better than I hoped and so awesome! My customer appreciiated it too! And the labels matched in color perfecty too!

Tags

Cards
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 137887351179637802
Created on: 11/19/2017, 10:04 AM
Rating: G