Tap / click on image to see more RealViewsTM
Sale Price $20.72.  
Original Price $25.90 Comp. value
per bandana
You save 20%

Viking Pattern Blue Bandana

Qty:
Adult/Large 22" x 22"
-$2.75

Other designs from this category

About Bandanas

Sold by

Style: Adult / Large 22" x 22" Bandana

Not just for cowboys and bandits, these square bandanas take on your artwork or text in full, vibrant color. Fashionable and functional, cover your nose and mouth, protect your neck, or use it as an adorable dog accessory!

  • All over edge-to-edge printed design
  • Lightweight fabric that breathes well and dries quickly
  • Two sizes available: 18" x 18" and 22" x 22"
  • Materials: 100% spun polyester
  • Printed on one side only
  • Reusable. Wash with proper sanitization after each use
  • Please note that the our bandana face coverings are not intended as medical/personal protective equipment

Disclaimer: The bandana face coverings should not be used (1) in any surgical setting or where significant exposure to liquid, bodily or other hazardous fluids, may be expected; (2) in a clinical setting where the infection risk level through inhalation exposure is high; or (3) in the presence of a high intensity heat source or flammable gas. We make no warranties, either express or implied, that the bandana face coverings prevent infection or the transmission of viruses or diseases.

About This Design

Viking Pattern Blue Bandana

Viking Pattern Blue Bandana

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating233 Total Reviews
199 total 5-star reviews21 total 4-star reviews5 total 3-star reviews2 total 2-star reviews6 total 1-star reviews
233 Reviews
Reviews for similar products
5 out of 5 stars rating
By Matthew O.October 6, 2020Verified Purchase
Zazzle Reviewer Program
The bandana itself is very durable. It stands washing cycles very well. Also the bandana is quite warm when worn around the neck. Overall I'm quite satisfied with the material and the quality of the product. The design is excellent quality. Printed exactly as it is shown online with crisp lines and great detail. I was a little surprised when the bandana colors came out slightly darker than what was shown but taking into account the dye sublimation printing process and type of material I'm not disappointed. I'm very satisfied with the printed results.
Original product
5 out of 5 stars rating
By Betsy S.August 6, 2021Verified Purchase
Adult/Large 22" x 22"
Zazzle Reviewer Program
Loved this product great quality and the design comes out even better in person. Great printing amazing design! it comes out two different colors on each half and it is so cool! Like two different bandanas in one! See the pictures for the two colors! (both same bandana)
5 out of 5 stars rating
By Vanessa P.December 26, 2016Verified Purchase
Adult/Large 22" x 22"
Creator Review
These Bandana's are awesome! I ordered one for myself awhile back and then again recently as a gift for an artist that sells on etsy that I am very inspired by! Mallory loves it and that makes me so happy! These bandana's work great to be worn and used as room decoration hung on the walls or even for display use for other products! The coloration is lovely, soft material and overall great quality! They are perfect as gifts to friends or even to yourself.

Tags

Bandanas
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256936903817610629
Created on: 11/17/2017, 8:01 PM
Rating: G