Tap / click on image to see more RealViewsTM
Sale Price $21.92.  
Original Price $24.35 Comp. value
per bandana
You save 10%

Viking Pattern Blue Bandana

Qty:
22" - Adult
-$2.55

Other designs from this category

About Bandanas

Sold by

Style: Adult / Large 22" x 22" Bandana

Not just for cowboys and bandits, these square bandanas take on your artwork or text in full, vibrant color. Fashionable and functional, cover your nose and mouth, protect your neck, or use it as an adorable dog accessory!

  • All over edge-to-edge printed design
  • Lightweight fabric that breathes well and dries quickly
  • Two sizes available: 18" x 18" and 22" x 22"
  • Materials: 100% spun polyester
  • Printed on one side only
  • Reusable. Wash with proper sanitization after each use
  • Please note that the our bandana face coverings are not intended as medical/personal protective equipment

Disclaimer: The bandana face coverings should not be used (1) in any surgical setting or where significant exposure to liquid, bodily or other hazardous fluids, may be expected; (2) in a clinical setting where the infection risk level through inhalation exposure is high; or (3) in the presence of a high intensity heat source or flammable gas. We make no warranties, either express or implied, that the bandana face coverings prevent infection or the transmission of viruses or diseases.

About This Design

Viking Pattern Blue Bandana

Viking Pattern Blue Bandana

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating243 Total Reviews
205 total 5-star reviews22 total 4-star reviews5 total 3-star reviews2 total 2-star reviews9 total 1-star reviews
243 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Matthew O.October 6, 2020Verified Purchase
Zazzle Reviewer Program
The bandana itself is very durable. It stands washing cycles very well. Also the bandana is quite warm when worn around the neck. Overall I'm quite satisfied with the material and the quality of the product. The design is excellent quality. Printed exactly as it is shown online with crisp lines and great detail. I was a little surprised when the bandana colors came out slightly darker than what was shown but taking into account the dye sublimation printing process and type of material I'm not disappointed. I'm very satisfied with the printed results.
Original product
5.0 out of 5 stars rating
5 out of 5 stars rating
By Gravityx9 D.April 13, 2020Verified Purchase
22" - Adult
Creator Review
The scarf fabric is soft and easy to fold, stays in place. The scarf holds a knot firmly but easy to un-knot when needed. The stitching is tight and no loose threads were visible at the seams. The printing color is true to the online image. Only one side is printed but I like that because it will be used folded in half at an angle. When folded, the full design is visible. Designed so that either side can be used in the triangle shape, neither side will have the image upside down.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Goddess C.May 25, 2022Verified Purchase
22" - Adult
Creator Review
The circle containing Gaia is great for laying out tarot and oracle cards; the animals create a frame surrounding the cards. I'm excited to use this cloth for my altar as well. Whenever I see this cloth, it makes me smile and appreciate the natural beauty within this world. The printing quality is fantastic and reflects the coloration and saturation from the image. I love how soft and large these cloths are.

Tags

Bandanas
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256936903817610629
Created on: 11/17/2017, 8:01 PM
Rating: G