Tap / click on image to see more RealViewsTM
Sale Price $53.94.  
Original Price $63.45 Comp. value
per banner
You save 15%

Viking Pattern Blue Banner

Qty:
3' x 5'

Other designs from this category

About Banners

Sold by

Size: 3' x 5' Banner

Shout it from the rooftops, say it big and bold - it's time to get the word out! Indoors or out, our banners are here to help you advertise anything, from birthdays to graduation, weddings to anniversaries. We've got thousands of designs for you to browse through, along with 4 different size options.

  • Dimensions: 3'l x 5'w (horizontal) or 5'l x 3'w (vertical)
  • Edge-to-edge, full color vibrant print for a bold statement
  • Hemmed and thermally welded edges for neat finish
  • Choice of indoor or outdoor banners. Outdoor banners can be bought with metal grommets

Material: Indoor

Lightweight and durable, our 13 oz. vinyl material is best suited for indoor or short-term outdoor events. This white flexible material comes with an elegant matte finish, and is both fade and tear resistant.

About This Design

Viking Pattern Blue Banner

Viking Pattern Blue Banner

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating2.2K Total Reviews
2029 total 5-star reviews85 total 4-star reviews30 total 3-star reviews13 total 2-star reviews37 total 1-star reviews
2,194 Reviews
Reviews for similar products
5 out of 5 stars rating
By MrsErnestine C.June 19, 2017Verified Purchase
Vinyl Banner, 3' x 5', Indoor
Zazzle Reviewer Program
Bigger than I thought, which made it even better!!!...BEAUTIFUL!...topped off the candy buffet table ! THE PRINTING WAS TO THE PERFECTION!!!!
5 out of 5 stars rating
By Brooke C.October 8, 2020Verified Purchase
Vinyl Banner, 3' x 5', Indoor
Zazzle Reviewer Program
I purchased this banner to go in front of a bar we had set up for an outdoor party. Excellent quality! Will be able to use for years to come. Printing and colors were great
5 out of 5 stars rating
By Chong V.October 23, 2025Verified Purchase
Vinyl Banner, 2.5' x 6', Indoor
The quality was amazing! I got the indoor one, and I thought was going to be thin but it was very thick and was great for outdoor as well. It was the perfect welcome sign for our wedding. I absolutely love it and would recommend it to everyone who is planning to host an event! It will be a beautiful addition and will not disappoint! .

Tags

Banners
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256325634972916561
Created on: 11/20/2017, 11:22 AM
Rating: G