Tap / click on image to see more RealViewsTM
Sale Price $14.99.  
Original Price $16.65 Comp. value
per bottle opener
You save 10%

Viking Pattern Blue Bar Key

Qty:
Speed Bottle Opener
-$1.30
-$1.30

Other designs from this category

About Bottle Openers

Sold by

Style: Speed Bottle Opener

Pop those bottles like a pro! Used by bartenders, this professional stainless steel speed bottle opener has the length and design to open bottles with speed and ease. Customize yours with images, designs and text for a unique opener that shows off your style. Great as a gift for aspiring bartenders or for friends that like a good drink (or two)!

  • Dimensions: 1.5"w x 7"l x .125"h.
  • All over printing with protective coating.
  • Spinner ring included.
  • Stainless steel construction for extra durability.
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 1.6" x 7". For best results please add 1/11" bleed.

About This Design

Viking Pattern Blue Bar Key

Viking Pattern Blue Bar Key

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating228 Total Reviews
196 total 5-star reviews25 total 4-star reviews4 total 3-star reviews2 total 2-star reviews1 total 1-star reviews
228 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Andrea O.March 2, 2020Verified Purchase
Speed Bottle Opener
Zazzle Reviewer Program
Got this as a gift and my friend was in love! I was told the bar key is super durable and easy to use! Got one for my self soon after! I added 3 pictures and all 3 looked really clear, not blurry at all and there was no bleed. Added some text as well and the font was perfect!
5.0 out of 5 stars rating
5 out of 5 stars rating
By DawnMarie R.January 3, 2022Verified Purchase
Speed Bottle Opener
Zazzle Reviewer Program
Purchased 10 of these for the bartenders at my local hangout for Christmas. Had the new logo printed on both sides. They came out great!! Wonderfully done. Fantastic quality. Everyone loved them. Fast shipping. Easy to navigate to choose style, color and upload image. Would definitely recommend... !!! 😉👍🤣
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kat F.September 15, 2016Verified Purchase
Speed Bottle Opener
Zazzle Reviewer Program
This bottle opener is perfect for our summer days spent at the neighborhood pool. The product seems really durable and I love the nautical design and colors. I customized it with our last name so it doesn't get lost :). Colors printed beautifully and the design is nice and centered as it was when I ordered it.

Tags

Bottle Openers
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256192524466145680
Created on: 11/18/2017, 1:09 PM
Rating: G