Tap / click on image to see more RealViewsTM
Sale Price $21.44.  
Original Price $26.80 Comp. value
per mug
You save 20%

Viking Pattern Blue Beer Stein

Qty:
Stein
-$8.95
-$7.95
-$7.00
-$4.10
-$3.15
+$4.95
Gray/Blue

Other designs from this category

About Mugs

Sold by

Style: Stein

Don't just drink beer, celebrate it with a made-to-order Zazzle beer stein. Our traditional German beer mug features ornate borders at the rim and base and a detailed handle. Honor your beer with the right vessel for the job, or give a stein to the beer lover in your life.

  • Available in 2 colors – white with metallic gold and gray with blue color
  • Dimensions:
    • Grey/Blue 22-ounce: 3" D x 6.6" H
    • White/Gold 20-ounce: 3" D x 6.6" H
  • Hand wash
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Viking Pattern Blue Beer Stein

Viking Pattern Blue Beer Stein

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating682 Total Reviews
573 total 5-star reviews77 total 4-star reviews17 total 3-star reviews6 total 2-star reviews9 total 1-star reviews
682 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kimball M.June 26, 2019Verified Purchase
Stein, Blue/Grey 22 oz / White/Gold 20 oz
Creator Review
My friends enjoyed this present I made for them. Great printing as always!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Bob's S.May 6, 2017Verified Purchase
Stein, Blue/Grey 22 oz / White/Gold 20 oz
Creator Review
Actually, I didn’t know what to expect when I ordered this mug, but the quality of the mug is over the top. It’s thick, has weight to it, durable, easy to wash... just an overall great product. When I received my mug through the mail, I saw exactly what I saw on the ZAZZLE site: clarity of the image, color scheme, and clarity of the font print. I’ve not had any problems with image or font fading either.
5.0 out of 5 stars rating
5 out of 5 stars rating
By SHARLA C.November 16, 2021Verified Purchase
Stein, Blue/Grey 22 oz / White/Gold 20 oz
Zazzle Reviewer Program
This stein was out of stock for the longest time. I kept checking to see if it was back and low and behold - Eureka! It was back in stock. I am so glad I waited and didn't attempt to try to find something else. The pricing is extremely good as well for a custom, personalized gift! And since I had already uploaded the design, all I had to do was add it to my cart and purchase it. It looks amazing! Better than expected, great quality and just beautiful! I love it and can't wait to give it to my boss for Christmas! Thank you so much, Zazzle. The designer did a great job! The printing is perfect and the colors are on point. Plus, the mug itself is a great quality piece. Beautiful! I love it!

Tags

Mugs
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 168214304985240400
Created on: 11/18/2017, 1:05 PM
Rating: G