Tap / click on image to see more RealViewsTM
Sale Price $20.28.  
Original Price $23.85 Comp. value
per ornament
You save 15%

Viking Pattern Blue Ceramic Ornament

Qty:
Ceramic Heart Ornament
-$3.85
-$3.85
-$3.85
-$5.15
-$5.15
-$5.15
-$1.30
-$1.30
-$1.30
+$6.40
+$6.40

Other designs from this category

About Ornaments

Sold by

Style: Ceramic Heart Ornament

Bring a lot more holiday cheer to your tree with a custom ceramic ornament. Add family photos, images and personal message to both sides of this ornament. A strand of gold thread makes it easy to hang this fantastic keepsake.

  • Dimensions: 3"l x 2.8"w; Weight: 1.375 oz.
  • Made of white porcelain
  • Full-color, full-bleed printing
  • Printing on both sides
  • Thread does not come attached/tied
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 3" x 2.8". For best results please add 1/8" bleed.

About This Design

Viking Pattern Blue Ceramic Ornament

Viking Pattern Blue Ceramic Ornament

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating11.6K Total Reviews
9462 total 5-star reviews1280 total 4-star reviews373 total 3-star reviews174 total 2-star reviews283 total 1-star reviews
11,572 Reviews
Reviews for similar products
5 out of 5 stars rating
By Teddi B.December 14, 2021Verified Purchase
Ceramic Heart Ornament
Zazzle Reviewer Program
After seeing the quality and speedy service I ended up ordering two more for the kid’s Christmas trees. Very impressive! Very professionally done!
5 out of 5 stars rating
By L.November 11, 2025Verified Purchase
Ceramic Heart Ornament
It was easy to design and get the order fulfilled.
5 out of 5 stars rating
By Cynthia N.December 27, 2022Verified Purchase
Ceramic Heart Ornament
Zazzle Reviewer Program
What a beautiful ceramic heart Zazzle produced! It was so easy to incorporate the dong's photo and it was so well appreciated as a Christmas Gift! Hundreds of fonts to chose from and create the perfect gift! I ordered several for different friend's Christmas gifts and they all loved seeing their pet on the ornament! Thank you Zazzle for a sharp looking gift!

Custom Made Easy

  • Step 1: Choose your favorite design.

    Step 1:

    Choose your favorite design.

  • Step 2: Select your desired size, shape and paper type

    Step 2:

    Select your desired shape and material

  • Step 3: Click 'Personalize' to enter your custom text and images.

    Step 3:

    Click 'Personalize' to enter your custom text and images.

  • Step 4: When finished customizing your card, click 'Done' to see your final product!

    Step 4:

    When finished customizing, click 'Done' to see your final product!

Tags

Ornaments
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 175880270232656110
Created on: 11/18/2017, 12:03 PM
Rating: G