Tap / click on image to see more RealViewsTM
Sale Price $53.28.  
Original Price $59.20 Comp. value
per fleece blanket
You save 10%

Viking Pattern Blue Fleece Blanket

Qty:
  1. Size

Other designs from this category

About Fleece Blankets

Sold by

Size: Fleece Blanket, 50"x60"

It’s hard to cuddle by yourself. But with these fully customizable comfy fleece blankets, you won’t have to anymore. Customize the entire front panel and wrap yourself in personalized plush luxury. Delicate, soft and colorful, it's the perfect blanket for picnics in the park, outdoor events, and cozy winter snuggles.

  • Available in 3 different sizes: small (30"x40"); medium(50" x 60"); large(60" x 80").
  • 100% buttery soft and cozy polyester fleece
  • Edge-to-edge sublimation printing in vibrant full color
  • Sturdy double edge stitching for a clean finish
  • Back color is off-white
  • Machine washable, gentle cycle, mild detergent
  • Tumble dry low
This product is recommended for ages 2+

About This Design

Viking Pattern Blue Fleece Blanket

Viking Pattern Blue Fleece Blanket

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating3.5K Total Reviews
2995 total 5-star reviews333 total 4-star reviews67 total 3-star reviews51 total 2-star reviews31 total 1-star reviews
3,477 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By SaraJuly 13, 2025Verified Purchase
Fleece Blanket, 50" x 60"
Love my new blanket, super soft, and more importantly, it keeps me warm just like my cat used to, and we can keep snuggling on the sofa forever :).
5.0 out of 5 stars rating
5 out of 5 stars rating
By mariaDecember 14, 2021Verified Purchase
Fleece Blanket, 30" x 40"
Zazzle Reviewer Program
This product I bought for my sister and when I seen it I was so upset that I did not buy my self one. It's beautiful ,the quality the texture and the images all were perfect. Great. I even used some old photos that I had to find from my family websites and they still came out great.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Liv C.November 30, 2022Verified Purchase
Fleece Blanket, 50" x 60"
Zazzle Reviewer Program
We made this blanket for my parents 50th wedding anniversary rather than a birthday. We got eight of them one for each of my parents and a blanket for each sibling as a commemoration gift. I was worried the pictures would look blurry or pixelated but the quality was so great and the blanket is very soft. It's thinner but cozy. Really happy with this! .

Tags

Fleece Blankets
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256478076938277373
Created on: 11/18/2017, 12:45 PM
Rating: G