Tap / click on image to see more RealViewsTM
Sale Price $50.45.  
Original Price $59.35 Comp. value
per fleece blanket
You save 15%

Viking Pattern Blue Fleece Blanket

Qty:

Other designs from this category

About Fleece Blankets

Sold by

Size: Fleece Blanket, 50"x60"

It’s hard to cuddle by yourself. But with these fully customizable comfy fleece blankets, you won’t have to anymore. Customize the entire front panel and wrap yourself in personalized plush luxury. Delicate, soft and colorful, it's the perfect blanket for picnics in the park, outdoor events, and cozy winter snuggles.

  • Available in 3 different sizes: small (30"x40"); medium(50" x 60"); large(60" x 80").
  • 100% buttery soft and cozy polyester fleece
  • Edge-to-edge sublimation printing in vibrant full color
  • Sturdy double edge stitching for a clean finish
  • Back color is off-white
  • Machine washable, gentle cycle, mild detergent
  • Tumble dry low
This product is recommended for ages 2+

About This Design

Viking Pattern Blue Fleece Blanket

Viking Pattern Blue Fleece Blanket

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating3.3K Total Reviews
2885 total 5-star reviews326 total 4-star reviews59 total 3-star reviews45 total 2-star reviews23 total 1-star reviews
3,338 Reviews
Reviews for similar products
5 out of 5 stars rating
By S.July 13, 2025Verified Purchase
Fleece Blanket, Medium 50" x 60"
Love my new blanket, super soft, and more importantly, it keeps me warm just like my cat used to, and we can keep snuggling on the sofa forever :).
5 out of 5 stars rating
By m.December 14, 2021Verified Purchase
Fleece Blanket, Small 30" x 40"
Zazzle Reviewer Program
This product I bought for my sister and when I seen it I was so upset that I did not buy my self one. It's beautiful ,the quality the texture and the images all were perfect. Great. I even used some old photos that I had to find from my family websites and they still came out great.
5 out of 5 stars rating
By Priscilla C.December 10, 2021Verified Purchase
Fleece Blanket, Small 30" x 40"
Zazzle Reviewer Program
The product is so soft and I would recommend to you to purchase. I myself have ordered close to 20 and am giving as gifts. Because my pictures are not the right resolution for the larger size they are a little blurry but the overall results are great.

Tags

Fleece Blankets
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256478076938277373
Created on: 11/18/2017, 12:45 PM
Rating: G