Tap / click on image to see more RealViewsTM
Sale Price $0.99per flyer
Original Price $29.00Subtotal. Comp. value
Sale Price $24.75Subtotal.
You save 15%

Viking Pattern Blue Flyer

Qty:
Thin Matte Paper
-$0.06

Other designs from this category

About Flyers

Sold by

Size: 8.5" x 11"

Make your promotional materials stand out with a custom flyer. The perfect size for all of your promotional needs, you can upload your own photos, graphics, and logos to craft the perfect flyers for your event, party, or grand opening.

  • Dimensions: 8.5" L x 11" W
  • Larger than quarter-page size
  • Envelopes not included
  • High quality, full-color, full-bleed printing
  • Customize both sides at no extra cost
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 8.5" x 11". For best results please add 1/16" bleed

Paper Type: Thin Matte Paper

Crisp, clean, and professional—our Thin Matte paper is lightweight yet polished, making it ideal for business mailings, flyers, and folded pieces that need a refined, no-glare finish.

  • Made in Italy, printed in the USA
  • Contains 50% recycled content (10% post-consumer, 40% pre-consumer waste)

About This Design

Viking Pattern Blue Flyer

Viking Pattern Blue Flyer

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating808 Total Reviews
676 total 5-star reviews87 total 4-star reviews21 total 3-star reviews5 total 2-star reviews19 total 1-star reviews
808 Reviews
Reviews for similar products
5 out of 5 stars rating
By Rosangela M.July 16, 2019Verified Purchase
Flyer Paper, Size: 8.5" x 11", Paper: Thin Glossy Paper
Zazzle Reviewer Program
In such difficult moments zazzle over did themselves. As I was looking for my grandpas funeral arrangements I came across this product and thought it would be perfect. The funeral home sells stationary for $200 and zazzle gave me a great product for much less. Highly recommend. Just as I wrote it in the computer
5 out of 5 stars rating
By Gail C.October 28, 2025Verified Purchase
Flyer Paper, Size: 8.5" x 11", Paper: Thin Matte Paper
The flyer looked very professional and everything was printed perfectly! It was printed on high quality paper as well. I was absolutely satisfied with the completed product.
5 out of 5 stars rating
By AnonymousNovember 20, 2025Verified Purchase
Flyer Paper, Size: 8.5" x 11", Paper: Thin Glossy Paper
Ordered these for a celebration of life they turned out amazing ! Great quality ! Had some issues with the shipping but they took care of it right away ! .

Tags

Flyers
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 244564746715675103
Created on: 11/20/2017, 11:48 AM
Rating: G 
Related Searches
flyer templatesflyers