Tap / click on image to see more RealViewsTM
Sale Price $12.52.  
Original Price $15.65 Comp. value
per tag
You save 20%

Viking Pattern Blue Luggage Tag

Qty:

Other designs from this category

About Luggage Tags

Sold by

Style: Double-sided

Stand out in a crowd at the baggage carousel with a custom luggage tag from Zazzle! Sturdy and weatherproof, this luggage tag is ready to stand-up to the travel demands of any road warrior or adventure seeker. Printed using the AcryliPrint®HD printing process, your baggage tag shows designs, text, and photos in vibrant clarity and brilliant colors. Customize it with your information and escape bag mix ups for years to come!

  • Dimensions: 2"l x 3.5"w (standard business card size)
  • Made of ultra-durable acrylic
  • UV resistant and waterproof
  • Leather luggage strap included
  • Printed on both sides
This product is recommended for ages 13+

About This Design

Viking Pattern Blue Luggage Tag

Viking Pattern Blue Luggage Tag

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating4.4K Total Reviews
4014 total 5-star reviews290 total 4-star reviews75 total 3-star reviews19 total 2-star reviews28 total 1-star reviews
4,426 Reviews
Reviews for similar products
5 out of 5 stars rating
By Maisa M.March 8, 2024Verified Purchase
Acrylic Luggage Tag
As an artist I think this personalized luggage Tag is extremely essential, especially that I was given the option to add the barcode to my website. Exactly what I imagined it. Worth every penny ❤️
5 out of 5 stars rating
By S.October 1, 2021Verified Purchase
Acrylic Luggage Tag
Zazzle Reviewer Program
I ordered a set of Mickey and Minnie at the same time. Although I had the shipping trouble, I am so thrilled when I finally had them together. It is a perfect gift for a married couple. Wording are clear. beautiful printing.
5 out of 5 stars rating
By Symie D.January 18, 2022Verified Purchase
Acrylic Luggage Tag
Zazzle Reviewer Program
I love these luggage tags. They're very durable. The printing is all at your fingertips. I love designing them and more than anything giving them as gifts! Everyone should have one.. Printing is great. The colors came out perfectly vivid. The product is very classy looking.

Tags

Luggage Tags
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256722126263163913
Created on: 7/28/2017, 10:01 PM
Rating: G