Tap / click on image to see more RealViewsTM
Sale Price $42.93.  
Original Price $50.50 Comp. value
per set of 50 napkins
You save 15%

Viking Pattern Blue Napkins

Qty:
White

Other designs from this category

About Paper Napkins

Sold by

Style: Coined Cocktail

A good celebration is as much about the presentation as it is about food. Serve up the party with custom personalized paper napkins that look good tucked in the collar or draped over your lap.

  • Dimensions: 4.75"l x 4.75"w (folded), 3 ply
  • Printed in full color on your choice of white or ecru colored napkins
  • Coined or standard napkin styles available
  • Sold in quantities of 50
  • Buy in bulk and save!
  • This product is food contact safe
Tip: When ordering napkins, the general rule is 3 napkins per guest.

About This Design

Viking Pattern Blue Napkins

Viking Pattern Blue Napkins

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating3.1K Total Reviews
2586 total 5-star reviews236 total 4-star reviews77 total 3-star reviews56 total 2-star reviews108 total 1-star reviews
3,063 Reviews
Reviews for similar products
5 out of 5 stars rating
By Sandra R.August 19, 2025Verified Purchase
Paper Napkins, Standard Cocktail
Excellent detail. The party concept was barbershop conversations. Napkins were half folded, placed along other objects. Will I reorder again, surely will be. Next concept, I can't tell you.🙂 Thanks .
5 out of 5 stars rating
By Elizabeth J.May 10, 2022Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
Excellent quality and adorable image. Excellent printing and appeared just as I hoped
5 out of 5 stars rating
By Svtlana B.January 1, 2022Verified Purchase
Paper Napkins, Standard Cocktail
Zazzle Reviewer Program
Great 👍🏽 Very good job. Would recommend. 👍🏽 Very well!! Really good job

Tags

Paper Napkins
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256214417618707333
Created on: 11/18/2017, 4:46 PM
Rating: G