• Events
Tap / click on image to see more RealViewsTM
Sale Price $26.35.  
Original Price $31.00 Comp. value
per tie
You save 15%

Viking Pattern Blue Neck Tie

Qty:

    Other designs from this category

    About Ties

    Sold by

    Style: Tie

    Upgrade your wardrobe a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

    • Dimensions:
      • Length: 55"
      • Width: 4" (at widest point)
    • Printed in vibrant full color
    • Made from 100% polyester; silky finish
    • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customize
    • Dry clean only

    About This Design

    Viking Pattern Blue Neck Tie

    Viking Pattern Blue Neck Tie

    Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

    Customer Reviews

    4.5 out of 5 stars rating2.5K Total Reviews
    1815 total 5-star reviews325 total 4-star reviews144 total 3-star reviews73 total 2-star reviews117 total 1-star reviews
    2,474 Reviews
    Reviews for similar products
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Jim L.March 10, 2013Verified Purchase
    Tie
    Creator Review
    The Pageant Tie is just what I wanted and everyone at church wants one. I have worn it several days now and each day more people come to me to see it and say how great it is. The printing is just as it should be. Each photo is clear and the color is great.
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Victoria L.September 2, 2021Verified Purchase
    Tie
    Zazzle Reviewer Program
    I love having the ability to create my own design for my fiancé and his groomsmen to wear at our wedding. Fabric is good quality. The design turned out great! Clear and true to color!
    5.0 out of 5 stars rating
    5 out of 5 stars rating
    By Henry B.November 30, 2025Verified Purchase
    Tie
    Oh my Goodness !!! I am very very humbled & gracious to obtain this handsome Boxing print necktie.. The quality is Superb. I being an very avid Boxing Enthusiasts will adorn this necktie with Boxing 🥊 Pride. Much Gratitude ! .

    Tags

    Ties
    scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
    All Products
    scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

    Other Info

    Product ID: 151059692602002001
    Created on: 7/28/2017, 10:06 PM
    Rating: G