Tap / click on image to see more RealViewsTM
Sale Price $26.35.  
Original Price $31.00 Comp. value
per tie
You save 15%

Viking Pattern Blue Neck Tie

Qty:

Other designs from this category

About Ties

Sold by

Style: Tie

Upgrade your wardrobe a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 55"
    • Width: 4" (at widest point)
  • Printed in vibrant full color
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customize
  • Dry clean only

About This Design

Viking Pattern Blue Neck Tie

Viking Pattern Blue Neck Tie

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.5 out of 5 stars rating2.4K Total Reviews
1786 total 5-star reviews323 total 4-star reviews136 total 3-star reviews67 total 2-star reviews102 total 1-star reviews
2,414 Reviews
Reviews for similar products
4 out of 5 stars rating
By Emily L.October 30, 2019Verified Purchase
Tie
Zazzle Reviewer Program
I bought this tie for a cosplay of Haruhi Fujioka for Halloween and anime conventions. It feels very nice and silky. It's my first tie ever, and I'm a pretty big fan since I always wanted a tie. It was longer than I expected it to be (quite a plus), but the purple stripe was also thinner than I expected it to be (a slight bit of a downer, but I don't mind too much). I had never used Zazzle before, but I am very impressed with the shipping time. I was looking for places to get a tie like this so last minute since the ties like this on Amazon were incompatible with Prime. Thus, I ended up here. I paid for express shipping, expected delivery October 30-31, and it arrived in the morning on the 30th. Very impressed. I might just use Zazzle again. The print job was okay. The colors were perfect, but as you can see in the pictures, the stripe was a little off-center, and there was a kink in the stripe around where it transitions from the wide end to the thin end. It should work perfectly for my cosplay, but it was a little too carelessly print to be a very professional tie.
5 out of 5 stars rating
By Jim L.March 10, 2013Verified Purchase
Tie
Creator Review
The Pageant Tie is just what I wanted and everyone at church wants one. I have worn it several days now and each day more people come to me to see it and say how great it is. The printing is just as it should be. Each photo is clear and the color is great.
5 out of 5 stars rating
By T.November 16, 2016Verified Purchase
Tie
Creator Review
It is a well made tie. My only issue is that it's a little shorter than I usually get, but it's still long enough. The design and colors of the hibiscus flowers was amazing. The right combination of pop and fading into the background. The colors stand out, but aren't overpowering.

Tags

Ties
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 151059692602002001
Created on: 7/28/2017, 10:06 PM
Rating: G