Tap / click on image to see more RealViewsTM
Sale Price $27.90.  
Original Price $31.00 Comp. value
per tie
You save 10%

Viking Pattern Blue Neck Tie

Qty:

Other designs from this category

The Zazzle Promise

  • Order with Confidence

    If something goes wrong on our end, we'll make it right, on every order. Learn more!

  • FREE Shipping

    Enjoy FREE shipping with a 30-day free trial of Zazzle Plus – Learn More!

  • Secure Shopping Guaranteed

    100% Secure payment with SSL Encryption.

About Ties

Sold by

Style: Tie

Upgrade your wardrobe a custom tie from Zazzle! Design one-of-a-kind ties to match any suit, dress shirt, and occasion. Upload your own unique images and patterns, or browse thousands of stylish designs to wear in the office or on a night out in the town.

  • Dimensions:
    • Length: 55"
    • Width: 4" (at widest point)
  • Printed in vibrant full color
  • Made from 100% polyester; silky finish
  • Double-sided printing available at small upcharge. Check out the "Design Area" tab to the right to customize
  • Dry clean only

About This Design

Viking Pattern Blue Neck Tie

Viking Pattern Blue Neck Tie

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.5 out of 5 stars rating2.5K Total Reviews
1803 total 5-star reviews325 total 4-star reviews142 total 3-star reviews72 total 2-star reviews116 total 1-star reviews
2,458 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Jim L.March 10, 2013Verified Purchase
Tie
Creator Review
The Pageant Tie is just what I wanted and everyone at church wants one. I have worn it several days now and each day more people come to me to see it and say how great it is. The printing is just as it should be. Each photo is clear and the color is great.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Cyane W.May 10, 2017Verified Purchase
Tie
Zazzle Reviewer Program
This was such a hit! My brother was really excited to get it. The only thing he said was it was short -but he's 6'3" so it's hard for him to find ties that are long enough for him. Luckily, my other brother (who is the same height) managed to tie his tie so it fit, so he gave it to him. They both remarked on how much they like the ties and the material. Beautiful! Clear vibrant printing! The tie looks GREAT!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Victoria L.September 2, 2021Verified Purchase
Tie
Zazzle Reviewer Program
I love having the ability to create my own design for my fiancé and his groomsmen to wear at our wedding. Fabric is good quality. The design turned out great! Clear and true to color!

Tags

Ties
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 151059692602002001
Created on: 7/28/2017, 10:06 PM
Rating: G