Tap / click on image to see more RealViewsTM
Sale Price $20.53.  
Original Price $24.15 Comp. value
per spiral notebook
You save 15%

Viking Pattern Blue Notebook

Qty:
8.5" x 11" Deluxe Spiral Notebook
Wide Ruled
Black

Other designs from this category

About Spiral Notebooks

Sold by

Style: 8.5" x 11" Deluxe Spiral Notebook

Accessorize while you organize with these hand made spiral notebooks. The front and back covers are customizable with your images and text, and the notebook covers are laminated to ensure durability. Choose from 4 notebook styles, hardcover or softcover versions, 7 different spiral colors and 10 page design options to make your one-of-a-kind notebook today.

  • Dimensions: 8.5" l x 11" w
  • Hardcover or Softcover
  • Page Count: 60 sheets, 120 pages
  • 60 lb. durable text smooth paper
  • Laminated front and back covers, plain white inside
  • Choice of 7 colors for the spiral
  • Choice of 10 designs for the pages
  • CPSIA compliant
  • Suitable for ages 4+

About This Design

Viking Pattern Blue Notebook

Viking Pattern Blue Notebook

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating786 Total Reviews
710 total 5-star reviews56 total 4-star reviews6 total 3-star reviews3 total 2-star reviews11 total 1-star reviews
786 Reviews
Reviews for similar products
5 out of 5 stars rating
By Christina P.August 25, 2023Verified Purchase
8.5" x 8.5" Deluxe Spiral Notebook, White spiral, Sketch pages
Zazzle Reviewer Program
Zazzle has impressed us with providing us with exactly what we wanted & it’s so adorable. My daughter can pass this down to her daughter one day in her box of baby trinkets. 🩷🩷🩷. Printing is exactly as ordered! Each font, word, and color we chose is on point.
5 out of 5 stars rating
By Goddess C.May 25, 2022Verified Purchase
8.5" x 11" Deluxe Spiral Notebook, Black spiral, Sketch pages
Creator Review
This is such a fun notebook. When using it, if I find the need to ground myself or am searching for inspiration as to what to write, I can reference the root chakra or throat chakra (respectively) illustrations for sample exercises to access those energies. I plan to gift one of these notebooks to my favorite yoga teacher in gratitude for her beautiful spirit and practices. I love how durable the softcover journals are. There's no concern that the cover will break off from the binding. I also love that Zazzle allows for certain customizations, such as changing the color of the spiral or the paper inside the notebook. I'm a big fan of the sketch paper because it allows for writing and doodling but appreciate that I can get college or wide ruled paper instead, depending on the purpose for which I'm using the notebook.
5 out of 5 stars rating
By Jen A.November 9, 2021Verified Purchase
8.5" x 11" Deluxe Spiral Notebook, Black spiral, Wide Ruled pages
Zazzle Reviewer Program
The product quality in my opinion is fantastic! It seems to be made with durable, long lasting materials, put into an incredible design. I would recommend this to anyone, and we'll be purchasing a few more soon for the upcoming holiday to give out as gifts. Absolutely 100% satisfied with the incredible printing, and images on this! I uploaded the images myself for the back of this and I was expecting one of them to be blurry yeah, but when I received it it was above and beyond more beautiful than I could have ever expected. Thank you so very much for an amazing printing job!

Tags

Spiral Notebooks
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256901698435672199
Created on: 11/19/2017, 10:12 AM
Rating: G