Tap / click on image to see more RealViewsTM
Sale Price $15.12.  
Original Price $16.80. Comp. value
Sale Price $1.89per paper plate.
You save 10%

Viking Pattern Blue Paper Plates

Qty:
7" Round Paper Plate
+$0.10
+$0.10

Other designs from this category

About Paper Plates

Sold by

Size and Style: 7" Round Paper Plate

Throw a spectacular party with fully customizable paper plates to match your theme! Each set of eight paper plates is printed on durable paper stock and decorated with your custom designs or photos. These plates are perfect for serving cake, appetizers, or salads. Order these with our paper napkins for a complete set of party tableware that your guests will love!

  • Dimensions: 7" diameter
  • FDA compliant for food contact safety
  • Perfect for cake, appetizers, or salads
  • Printed in USA

About This Design

Viking Pattern Blue Paper Plates

Viking Pattern Blue Paper Plates

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.5 out of 5 stars rating1.4K Total Reviews
1137 total 5-star reviews102 total 4-star reviews51 total 3-star reviews46 total 2-star reviews89 total 1-star reviews
1,425 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Stacey S.March 18, 2026Verified Purchase
Paper Plates, 9" Square Paper Plate
The watercolor and design are beautiful!!! Excellent Service .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Cristen S.February 6, 2026Verified Purchase
Paper Plates, 7" Square Paper Plate
These plates were absolutely perfect for a Camp Snoopy theme baby shower. The price point was definitely high; however, you did get a good amount of them with your purchase. The colors were vibrant and exactly as pictured on the site, and the plates were sturdy and excellent quality. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Stacey S.March 2, 2026Verified Purchase
Paper Plates, 9" Square Paper Plate
Beautiful to add to your holiday decor. Always perfect!!!

Tags

Paper Plates
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256625107117526098
Created on: 11/18/2017, 11:39 AM
Rating: G