Tap / click on image to see more RealViewsTM
Sale Price $13.44.  
Original Price $16.80. Comp. value
Sale Price $1.68per paper plate.
You save 20%

Viking Pattern Blue Paper Plates

Qty:
7" Round Paper Plate
+$0.10
+$0.10

Other designs from this category

About Paper Plates

Sold by

Size and Style: 7" Round Paper Plate

Throw a spectacular party with fully customizable paper plates to match your theme! Each set of eight paper plates is printed on durable paper stock and decorated with your custom designs or photos. These plates are perfect for serving cake, appetizers, or salads. Order these with our paper napkins for a complete set of party tableware that your guests will love!

  • Dimensions: 7" diameter
  • FDA compliant for food contact safety
  • Perfect for cake, appetizers, or salads
  • Printed in USA

About This Design

Viking Pattern Blue Paper Plates

Viking Pattern Blue Paper Plates

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.6 out of 5 stars rating1.4K Total Reviews
1103 total 5-star reviews100 total 4-star reviews46 total 3-star reviews42 total 2-star reviews70 total 1-star reviews
1,361 Reviews
Reviews for similar products
5 out of 5 stars rating
By Stacey S.March 18, 2026Verified Purchase
Paper Plates, 9" Square Paper Plate
The watercolor and design are beautiful!!! Excellent Service .
5 out of 5 stars rating
By Stacey S.March 2, 2026Verified Purchase
Paper Plates, 9" Square Paper Plate
Beautiful to add to your holiday decor. Always perfect!!!
5 out of 5 stars rating
By Debra W.May 31, 2020Verified Purchase
Paper Plates, 9" Round Paper Plate
Zazzle Reviewer Program
I ordered personalized baby shower plates and I loved them and they were delivered on time they were personalized with thanks for showering our little peanut. The printing turned out good but edge of plates had like tears around the edges I would recommend them to any one having a baby shower or party

Tags

Paper Plates
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256625107117526098
Created on: 11/18/2017, 11:39 AM
Rating: G