Tap / click on image to see more RealViewsTM
Sale Price $10.72.  
Original Price $13.40. Comp. value
Sale Price $5.36each.
You save 20% ends today

Viking Pattern Blue Pen

Qty:
Black
Black

Other designs from this category

About Pens

Sold by

Writing Ink Color: Black Ink Pen

Just because we all have smart phones and laptops doesn't mean the written word is on its way out. In fact, it means just that much more to receive a personal handwritten note! Arm yourself with your own writing mechanism by customizing your own one-of-a-kind pen, and continue to make statements in the good ol' fashioned way.

  • Minimum order of 2.
  • Click into action with your own one-of-a-kind pen.
  • Available in multiple color inks & trim accents.
  • Printed in full vibrant color that is sure to wow.
  • Extended life writing cartridges.
  • Proudly made in the USA.
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 4.02" x 1.36". For best results please add 0.24" bleed.

About This Design

Viking Pattern Blue Pen

Viking Pattern Blue Pen

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating470 Total Reviews
401 total 5-star reviews47 total 4-star reviews10 total 3-star reviews6 total 2-star reviews6 total 1-star reviews
470 Reviews
Reviews for similar products
5 out of 5 stars rating
By Denise A.December 15, 2017Verified Purchase
Zazzle Reviewer Program
Very nice blue, or black ink pen. I will be buying more. The print was fine. I can easily see the print. The flowers look great.
Original product
5 out of 5 stars rating
By Beth B.April 10, 2017Verified Purchase
Black Trim Pen, Black Ink
Zazzle Reviewer Program
Once again, Zazzle hasn't let me down! There product is so remarkable and so, Rey beautiful! Very hard to think of something to,get for a lady who will be 90! No doubt it will be cherished and the talk of the party. Fabulous! The pen will really go,well,with the Guest Book I ordered for her 90 th party. Then as a second thought, I thought of an album so she can keep,the pictures and any other mementos so might to put in this gorgeous book. Again! Great idea! Great product designed by Zazzle! Onmore thing! I had to have assistance and I got it with great help by one of there Customer Service Rep! He was able to,fix my problem. All around class company!
5 out of 5 stars rating
By Alissa K.October 18, 2025Verified Purchase
Black Trim Pen, Black Ink
Great product at a great price!

Tags

Pens
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256923905525289734
Created on: 11/20/2017, 11:38 AM
Rating: G