Tap / click on image to see more RealViewsTM
Sale Price $11.34.  
Original Price $12.60. Comp. value
Sale Price $5.67each.
You save 10%

Viking Pattern Blue Pen

Qty:
  1. Writing Ink Color: Black

  2. Trim Color

Other designs from this category

About Pens

Sold by

Writing Ink Color: Black Ink Pen

Just because we all have smart phones and laptops doesn't mean the written word is on its way out. In fact, it means just that much more to receive a personal handwritten note! Arm yourself with your own writing mechanism by customizing your own one-of-a-kind pen, and continue to make statements in the good ol' fashioned way.

  • Minimum order of 2.
  • Click into action with your own one-of-a-kind pen.
  • Available in multiple color inks & trim accents.
  • Printed in full vibrant color that is sure to wow.
  • Extended life writing cartridges.
  • Proudly made in the USA.
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 4.02" x 1.36". For best results please add 0.24" bleed.

About This Design

Viking Pattern Blue Pen

Viking Pattern Blue Pen

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating485 Total Reviews
410 total 5-star reviews47 total 4-star reviews10 total 3-star reviews7 total 2-star reviews11 total 1-star reviews
485 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Gravityx9 D.May 19, 2026Verified Purchase
Red Trim Pen, Black Ink
Creator Review
The ink print is nice, no globs of ink on the paper, as I write. Clear, clean and smooth flow. The colors of the pen design are vibrant. Fun to have a pen that I can easily identify! I'll be definitely purchasing Zazzle ink pens as stocking stuffers for family!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Alissa K.October 18, 2025Verified Purchase
Black Trim Pen, Black Ink
Great product at a great price!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kimee D.July 15, 2020Verified Purchase
Black Trim Pen, Black Ink
Zazzle Reviewer Program
When I ordered the pens I thought they would be a sticker & you could clearly see the line. NO YOU CAN'T! This is really high quality. The pen feels good in your hand, the ink is awesome. I just ordered 4 more! I thought it would be a cheap sticker but it's quality. It doesn't feel like a sticker, I have no idea how they did this but it's perfect. The colors are true. LOVE THIS PEN.

Tags

Pens
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256923905525289734
Created on: 11/20/2017, 11:38 AM
Rating: G