Tap / click on image to see more RealViewsTM
Sale Price $9.35.  
Original Price $11.00 Comp. value
per pad
You save 15%

Viking Pattern Blue Post-it Notes

Qty:
4" x 3"
+$6.90
-$1.40
+$19.35

Other designs from this category

About Post-it® Notes

Sold by

Size: Post-it® Notes 4" x 3"

When your mind is brimming with to-dos, keep it together with a pad of custom 3M Post-it® Notes. Jot down urgent memos, lists, or a sweet note to special someone such as, "Do NOT forget the milk!" Each 4"x3" pad comes with 50 sticky notes printed in full color with your graphics, text, or photos. If Post-it® Notes are going to be on your desk anyway, they might as well be creatively personal.

  • Authentic 3M Post-it® Notes
  • Dimensions: 4" x 3" (Adhesive side: 4" edge)
  • Printed in full color on 50-sheet white Post-it® Notes paper
  • Buy in bulk and save
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 4" x 2.8". For best results please add 1/16" bleed.

About This Design

Viking Pattern Blue Post-it Notes

Viking Pattern Blue Post-it Notes

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating1.9K Total Reviews
1631 total 5-star reviews172 total 4-star reviews31 total 3-star reviews7 total 2-star reviews12 total 1-star reviews
1,853 Reviews
Reviews for similar products
5 out of 5 stars rating
By Matty W.May 18, 2022Verified Purchase
Post-It® Notes, 4" x 3"
Zazzle Reviewer Program
Using this post it note pad for Friday Night Magic. It is perfect and very excited to use it. Will be ordering more. Printing is perfect. Just how it appears online.
5 out of 5 stars rating
By Rachael L.February 4, 2022Verified Purchase
Post-It® Notes, 4" x 3"
Creator Review
Here are a couple of delightful examples of the "Sunset Script" Post-it Note pad...It looks so wonderfully delicate...almost too pretty to write on...well, almost... So impressed...These look exactly like the photo on the website...Great imagery...
5 out of 5 stars rating
By Georgina B.June 15, 2021Verified Purchase
Post-It® Notes, 3" x 3"
Creator Review
Love how this turned out, clean and bright, perfect for notes and the design turned out really clean! Clean, and bright, all pages came out great!

Tags

Post-it® Notes
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256866823467017474
Created on: 11/19/2017, 10:08 AM
Rating: G