Tap / click on image to see more RealViewsTM
Sale Price $26.73.  
Original Price $29.70 Comp. value
per wood art stamp
You save 10%

Viking Pattern Blue Rubber Stamp

Qty:
Wooden Handle
-$1.75
None
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95

Other designs from this category

The Zazzle Promise

  • Order with Confidence

    If something goes wrong on our end, we'll make it right, on every order. Learn more!

  • FREE Shipping

    Enjoy FREE shipping with a 30-day free trial of Zazzle Plus – Learn More!

  • Secure Shopping Guaranteed

    100% Secure payment with SSL Encryption.

About Wood Art Stamps

Sold by

Size: 2" x 2"

Put your mark on it. Upload a design, logo, pattern, or text to create a custom maple wood stamp that's all yours. Laser-engraved on a foam cushion for crisp, clean impressions every time. Great for scrapbooking, card making, gift tags, packaging, and any paper craft that needs a personal touch.

  • Available in six sizes
  • Optional wooden handle for easier stamping
  • Optional Color Box® permanent ink pad (4" L x 0.5" W x 2.5" H, raised pad surface)
  • Additional Color Box® ink pad colors available here
This product is recommended for ages 13+

About This Design

Viking Pattern Blue Rubber Stamp

Viking Pattern Blue Rubber Stamp

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating2.9K Total Reviews
2517 total 5-star reviews245 total 4-star reviews67 total 3-star reviews51 total 2-star reviews66 total 1-star reviews
2,946 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By AnonymousSeptember 5, 2025Verified Purchase
4" x 5" Wood Art Rubber Stamp, Ink Pad Color = None, Orientation = Vertical, Handle = Wooden Handle
I wanted a stamp to mark shipping boxes for my business. Looks great and the stamp is high quality. Very happy with how it came out.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Yeshima P.January 25, 2025Verified Purchase
2.5" x 2.5" Wood Art Rubber Stamp, Ink Pad Color = None, Orientation = Horizontal, Handle = No Handle
I'm very pleased with my order. Just what I requested.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Andrea D.July 24, 2022Verified Purchase
4" x 5" Wood Art Rubber Stamp, Ink Pad Color = None, Orientation = Vertical, Handle = Wooden Handle
Zazzle Reviewer Program
This stamp is exactly what was wanting! My logo is perfectly transferred when using the ink pad! Well made, came quicker than expected as well. Excellent quality! All of my stamps for my business are fantastic! I am extremely happy with the product!

Tags

Wood Art Stamps
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256160543776141113
Created on: 11/20/2017, 11:38 AM
Rating: G