Tap / click on image to see more RealViewsTM
Sale Price $23.12.  
Original Price $27.20 Comp. value
per wood art stamp
You save 15%

Viking Pattern Blue Rubber Stamp

Qty:
Wooden Handle
-$1.50
None
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95
+$12.95

Other designs from this category

About Wood Art Stamps

Sold by

Size: 2" x 2"

Transform any craft project with a personalized maple wood stamp. Leave an impression by uploading a design, image, pattern, or text to make your unique stamp.

  • Available in six sizes
  • Laser engraved on foam cushion
  • Optional wooden handle
  • Optional Color Box® ink pad is permanent ink for scrapbooking and paper craft projects
  • Additional Color Box® ink pads in a variety of colors can be found by following this Link
  • Ink pad size: L 4”x W 2.5” x D 0.5”
  • Raised pad surface
This product is recommended for ages 13+

About This Design

Viking Pattern Blue Rubber Stamp

Viking Pattern Blue Rubber Stamp

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating2.9K Total Reviews
2483 total 5-star reviews242 total 4-star reviews65 total 3-star reviews45 total 2-star reviews60 total 1-star reviews
2,895 Reviews
Reviews for similar products
5 out of 5 stars rating
By AnonymousSeptember 5, 2025Verified Purchase
4" x 5" Wood Art Rubber Stamp, Ink Pad Color = None, Orientation = Vertical, Handle = Wooden Handle
I wanted a stamp to mark shipping boxes for my business. Looks great and the stamp is high quality. Very happy with how it came out.
5 out of 5 stars rating
By Yeshima P.January 25, 2025Verified Purchase
2.5" x 2.5" Wood Art Rubber Stamp, Ink Pad Color = None, Orientation = Horizontal, Handle = No Handle
I'm very pleased with my order. Just what I requested.
5 out of 5 stars rating
By Andrea D.July 24, 2022Verified Purchase
4" x 5" Wood Art Rubber Stamp, Ink Pad Color = None, Orientation = Vertical, Handle = Wooden Handle
Zazzle Reviewer Program
This stamp is exactly what was wanting! My logo is perfectly transferred when using the ink pad! Well made, came quicker than expected as well. Excellent quality! All of my stamps for my business are fantastic! I am extremely happy with the product!

Tags

Wood Art Stamps
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256160543776141113
Created on: 11/20/2017, 11:38 AM
Rating: G