• Events
Tap / click on image to see more RealViewsTM
Sale Price $25.25.  
Original Price $29.70 Comp. value
per wood art stamp
You save 15%

Viking Pattern Blue Rubber Stamp

Qty:
  1. Size

  2. Handle

  3. Ink Pad Color: None

Other designs from this category

About Wood Art Stamps

Sold by

Size: 2" x 2"

Put your mark on it. Upload a design, logo, pattern, or text to create a custom maple wood stamp that's all yours. Laser-engraved on a foam cushion for crisp, clean impressions every time. Great for scrapbooking, card making, gift tags, packaging, and any paper craft that needs a personal touch.

  • Available in six sizes
  • Optional wooden handle for easier stamping
  • Optional Color Box® permanent ink pad (4" L x 0.5" W x 2.5" H, raised pad surface)
  • Additional Color Box® ink pad colors available here
This product is recommended for ages 13+

About This Design

Viking Pattern Blue Rubber Stamp

Viking Pattern Blue Rubber Stamp

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating3K Total Reviews
2528 total 5-star reviews245 total 4-star reviews68 total 3-star reviews55 total 2-star reviews73 total 1-star reviews
2,969 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Tiffany D.August 23, 2026 • Verified Purchase
4" x 5" Wood Art Rubber Stamp, Ink Pad Color = None, Orientation = Vertical, Handle = Wooden Handle
This is the best business investment I could have made! It looks clean and clear when stamped. I couldn't ask for more. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Wendy A.July 15, 2026 • Verified Purchase
2" x 2" Wood Art Rubber Stamp, Ink Pad Color = None, Orientation = Horizontal, Handle = Wooden Handle
The stamp is perfect - I was worried that the text would be too small to read clearly but everything is crisp and legible. The only inconsistencies are due to me not being careful when inking. The stamp washes well and I would definitely buy again from here. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By AnonymousSeptember 5, 2025 • Verified Purchase
4" x 5" Wood Art Rubber Stamp, Ink Pad Color = None, Orientation = Vertical, Handle = Wooden Handle
I wanted a stamp to mark shipping boxes for my business. Looks great and the stamp is high quality. Very happy with how it came out.

Tags

scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256160543776141113
Created on: 11/20/2017, 11:38 AM
Rating: G