Tap / click on image to see more RealViewsTM
Sale Price $69.62.  
Original Price $81.90 Comp. value
per skateboard
You save 15%

Viking Pattern Blue Skateboard

Qty:

Other designs from this category

About Skateboards

Sold by

Deck Type: 7 3/4" Skateboard Deck

Whether you're doing grinds on the half-pipe or kickflips in the street, this competition shaped board has supreme pop! Our decks are made of the best quality hard-rock maple and with our one-of-a-kind printing process; you get the best skateboard available in the world.

  • Professional quality skateboard deck made from the very best ingredients
  • Seven plies of premium USA Maple from the Great Lakes region
  • Skateboard specific glue from Franklin.

About This Design

Viking Pattern Blue Skateboard

Viking Pattern Blue Skateboard

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating156 Total Reviews
134 total 5-star reviews14 total 4-star reviews2 total 3-star reviews2 total 2-star reviews4 total 1-star reviews
156 Reviews
Reviews for similar products
5 out of 5 stars rating
By William B.July 25, 2019Verified Purchase
7 3/4"
Zazzle Reviewer Program
I was surprised by just how great this board is. Very smooth ride. Perfect. The design has a lot of details and they all came through.
5 out of 5 stars rating
By FloWink D.November 12, 2025Verified Purchase
7 3/4"
Creator Review
Vivid colors and awesome quality as I expect from Zazzle! .
5 out of 5 stars rating
By AnonymousMay 7, 2015Verified Purchase
7 3/4"
Zazzle Reviewer Program
Amazing board quality, looks great and feels great! Arrived on time and might order another board soon. Also makes a great gift for skaters who love Japanese culture. The quality and color is awesome. Looks pretty good in person.

Tags

Skateboards
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 186963021895698856
Created on: 11/18/2017, 4:53 PM
Rating: G