Tap / click on image to see more RealViewsTM
Sale Price $20.72.  
Original Price $25.90 Comp. value
per stocking
You save 20%

Viking Pattern Blue Small Christmas Stocking

Qty:
Small
Brushed Poly
Red Back Panel

Other designs from this category

About Christmas Stockings

Sold by

Size: Christmas Stocking (9" x 16")

Stop Santa in his tracks this year with fabulous one-of-a-kind stockings. Made from bright and vividly printed polyester, these stockings are too pretty for coal. Give holiday cheer when you gift a 100% personalized stocking decorated with favorite pictures, treasured memories, cherished quotes, and more. The perfect addition to brighten any holiday mantle decor.

  • Dimension: 9" x 16"
  • Material: Available in 3 different styles; all 100% polyester
  • Sturdy sewn-in loop for hanging
  • Machine washable, lay flat to dry
  • Made in USA

About This Design

Viking Pattern Blue Small Christmas Stocking

Viking Pattern Blue Small Christmas Stocking

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating414 Total Reviews
339 total 5-star reviews58 total 4-star reviews9 total 3-star reviews5 total 2-star reviews3 total 1-star reviews
414 Reviews
Reviews for similar products
5 out of 5 stars rating
By A.December 17, 2020Verified Purchase
Double Sided Print Christmas Stocking, Brushed Poly
Zazzle Reviewer Program
This stocking arrived and I was in complete awe. It is so much more beautiful in person than in the photo. Such a stunning, classic stocking for our Angel babies first Christmas in heaven. My family and I will cherish this forever. The design design, colors and image quality are exactly as depicted in the photo. The fabric upgrade I selected cost a little more but definitely worth it. Everything turned out beautifully.
5 out of 5 stars rating
By D.December 7, 2019Verified Purchase
Double Sided Print Christmas Stocking, Brushed Poly
Zazzle Reviewer Program
Perfect! Exactly what I ordered! I uploaded a picture of my blue chow, and the screen print was incredible. the back side of the stocking was the red and black checkered print. my puppy's name was also printed on the cuff of the stocking. PERFECT! Highly recommend this product! My puppy's name was screen printed onto the cuff of the stocking, the font was perfect!
5 out of 5 stars rating
By Joanne E.December 5, 2016Verified Purchase
Red Back Panel Christmas Stocking, Brushed Poly
Zazzle Reviewer Program
I got this yesterday and I love it. The stocking came out what I wanted it to be as well as the design. This is a dream come true having my own customize stocking. Definitely, recommend it. Thanks zazzle! The print turned out really good and it is indeed a perfect gift for anyone for Christmas.

Tags

Christmas Stockings
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256886378358240183
Created on: 11/18/2017, 12:42 PM
Rating: G