• Events
Tap / click on image to see more RealViewsTM
Sale Price $21.21.  
Original Price $24.95 Comp. value
per stocking
You save 15%

Viking Pattern Blue Small Christmas Stocking

Qty:
  1. Size

  2. Fabric

  3. Back Side

Other designs from this category

About Christmas Stockings

Sold by

Size: Christmas Stocking (9" x 16")

Stop Santa in his tracks this year with fabulous one-of-a-kind stockings. Made from bright and vividly printed polyester, these stockings are too pretty for coal. Give holiday cheer when you gift a 100% personalized stocking decorated with favorite pictures, treasured memories, cherished quotes, and more. The perfect addition to brighten any holiday mantle decor.

  • Dimension: 9" x 16"
  • Material: Available in 3 different styles; all 100% polyester
  • Sturdy sewn-in loop for hanging
  • Machine washable, lay flat to dry
  • Made in USA

About This Design

Viking Pattern Blue Small Christmas Stocking

Viking Pattern Blue Small Christmas Stocking

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating434 Total Reviews
351 total 5-star reviews60 total 4-star reviews10 total 3-star reviews6 total 2-star reviews7 total 1-star reviews
434 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kim A.December 24, 2025 • Verified Purchase
Red Back Panel Christmas Stocking, Brushed Poly
This stocking is perfect and my son absolutely loves it. It’s a really big stocking, which is perfect!!!
5.0 out of 5 stars rating
5 out of 5 stars rating
By ArielDecember 17, 2020 • Verified Purchase
Double Sided Print Christmas Stocking, Brushed Poly
Zazzle Reviewer Program
This stocking arrived and I was in complete awe. It is so much more beautiful in person than in the photo. Such a stunning, classic stocking for our Angel babies first Christmas in heaven. My family and I will cherish this forever. The design design, colors and image quality are exactly as depicted in the photo. The fabric upgrade I selected cost a little more but definitely worth it. Everything turned out beautifully.
5.0 out of 5 stars rating
5 out of 5 stars rating
By DianeDecember 7, 2019 • Verified Purchase
Double Sided Print Christmas Stocking, Brushed Poly
Zazzle Reviewer Program
Perfect! Exactly what I ordered! I uploaded a picture of my blue chow, and the screen print was incredible. the back side of the stocking was the red and black checkered print. my puppy's name was also printed on the cuff of the stocking. PERFECT! Highly recommend this product! My puppy's name was screen printed onto the cuff of the stocking, the font was perfect!

Tags

scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256886378358240183
Created on: 11/18/2017, 12:42 PM
Rating: G