Tap / click on image to see more RealViewsTM
Sale Price $9.80.  
Original Price $11.50. Comp. value
Sale Price $0.98per sheet.
You save 15%

Viking Pattern Blue Stationery

Qty:
Thin Matte Paper

4.1pt thickness / 80 lb weight
Crisp white, smooth texture

+$0.14
+$0.14
+$0.14

Other designs from this category

About Stationery

Sold by

Size: 5.5" x 8.5"

The paper you write on can say just as much as the words written on it, so make your notes stand out with stationery for your home and office. Choose from 5 different paper types and write letters and business correspondence that will make everyone take notice!

  • 8.5"l x 5.5"w (portrait) or 5.5"l x 8.5"w (landscape)
  • Choice of five paper types
  • High quality, full-color, full-bleed printing
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 5.5" x 8.5". For best results please add 1/16" bleed

Paper Type: Thin Matte Paper

Crisp, clean, and professional—our Thin Matte paper is lightweight yet polished, making it ideal for business mailings, flyers, and folded pieces that need a refined, no-glare finish.

  • Made in Italy, printed in the USA
  • Contains 50% recycled content (10% post-consumer, 40% pre-consumer waste)

About This Design

Viking Pattern Blue Stationery

Viking Pattern Blue Stationery

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating391 Total Reviews
321 total 5-star reviews42 total 4-star reviews19 total 3-star reviews4 total 2-star reviews5 total 1-star reviews
391 Reviews
Reviews for similar products
5 out of 5 stars rating
By Michael P.June 5, 2023Verified Purchase
Stationery Paper, Size: 5.5" x 8.5", Paper: Thin Matte Paper, Envelopes: None
Zazzle Reviewer Program
I found the design function on Zazzle easy to use and was pleased with the range of design choices for the stationary. The printing was crisp, clear and professional. The stationary looks as though it was created by a premium printing shop.
5 out of 5 stars rating
By Susan H.February 21, 2024Verified Purchase
Stationery Paper, Size: 5.5" x 8.5", Paper: Recycled, Envelopes: None
Zazzle Reviewer Program
Product is beautiful and exactly what I expected. Colors & image is clear & vibrant. Paper thickness is spot on.
5 out of 5 stars rating
By Kay H.November 20, 2020Verified Purchase
Stationery Paper, Size: 5.5" x 8.5", Paper: Thin Matte Paper, Envelopes: None
Zazzle Reviewer Program
There is no better way to class up your Xmas season with a note like this. I am going to order more. Once I got started I could not stop. Perfect! I loved the antique look.

Tags

Stationery
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 229486491158181475
Created on: 11/18/2017, 12:08 PM
Rating: G