• Events
Tap / click on image to see more RealViewsTM
Sale Price $9.90.  
Original Price $11.00. Comp. value
Sale Price $0.99per sheet.
You save 10%

Viking Pattern Blue Stationery

Qty:
  1. Paper Type

  2. Envelopes

  3. Zazzle Logo

Other designs from this category

About Stationery

Sold by

Size: 5.5" x 8.5"

The paper you write on can say just as much as the words written on it, so make your notes stand out with stationery for your home and office. Choose from 5 different paper types and write letters and business correspondence that will make everyone take notice!

  • 8.5"l x 5.5"w (portrait) or 5.5"l x 8.5"w (landscape)
  • Choice of five paper types
  • High quality, full-color, full-bleed printing
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 5.5" x 8.5". For best results please add 1/16" bleed

Paper Type: Thin Matte Paper

Crisp, clean, and professional—our Thin Matte paper is lightweight yet polished, making it ideal for business mailings, flyers, and folded pieces that need a refined, no-glare finish.

  • Made in Italy, printed in the USA
  • Contains 50% recycled content (10% post-consumer, 40% pre-consumer waste)

About This Design

Viking Pattern Blue Stationery

Viking Pattern Blue Stationery

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.6 out of 5 stars rating407 Total Reviews
324 total 5-star reviews44 total 4-star reviews24 total 3-star reviews6 total 2-star reviews9 total 1-star reviews
407 Reviews
Reviews for similar products
4.0 out of 5 stars rating
4 out of 5 stars rating
By l.May 4, 2026Verified Purchase
Stationery Paper, Size: 5.5" x 8.5", Paper: Thin Matte Paper, Envelopes: None
The stationery is beautiful. I ordered the white linen paper, and it was a perfect weight. The only disappointment was the envelopes - they are larger than the paper, as though someone would not fold it to send it. They are so large they require extra postage, so I will just be throwing them out. There’s no indication of their large size in the description. Better to just order the stationery, and get your own normal-sized envelopes. .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Michael P.June 5, 2023Verified Purchase
Stationery Paper, Size: 5.5" x 8.5", Paper: Thin Matte Paper, Envelopes: None
Zazzle Reviewer Program
I found the design function on Zazzle easy to use and was pleased with the range of design choices for the stationary. The printing was crisp, clear and professional. The stationary looks as though it was created by a premium printing shop.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Susan H.February 21, 2024Verified Purchase
Stationery Paper, Size: 5.5" x 8.5", Paper: Recycled, Envelopes: None
Zazzle Reviewer Program
Product is beautiful and exactly what I expected. Colors & image is clear & vibrant. Paper thickness is spot on.

Tags

scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 229486491158181475
Created on: 11/18/2017, 12:08 PM
Rating: G