Tap / click on image to see more RealViewsTM
Sale Price $88.00.  
Original Price $110.00 Comp. value
per throw blanket
You save 20% ends today

Viking Pattern Blue Throw Blanket

Qty:

Other designs from this category

About Throw Blankets

Sold by

Size: Throw Blanket

This all-season throw blanket is designed for curling up with a cup of hot cocoa or relaxing on a summer evening with a cool glass of lemonade. Put a unique and stylish touch on your décor with your favorite patterns or designs or make one with your family photo memories for grandparents, moms, and dads!

  • Dimensions: 54"l x 38"w
  • Material: 100% polyester; soft touch
  • Hand wash cold. Do not bleach. Line dry. Do not wring.
  • Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 55.13" x 34.75"

About This Design

Viking Pattern Blue Throw Blanket

Viking Pattern Blue Throw Blanket

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.6 out of 5 stars rating182 Total Reviews
137 total 5-star reviews33 total 4-star reviews6 total 3-star reviews3 total 2-star reviews3 total 1-star reviews
182 Reviews
Reviews for similar products
5 out of 5 stars rating
By Antique I.November 15, 2021Verified Purchase
Throw Blanket
Creator Review
A beautiful small blanket that is perfect for covering your legs while curled up in front of the fire, or for a decorative touch on the sofa. We also think it looks brilliant as a Christmas table centerpiece. We are delighted with it. The colors are absolutely perfect. Vibrant yet traditional. The pattern retains its lovely details despite the texture of the fabric. Very classy product that will not disappoint as a gift.
5 out of 5 stars rating
By Tsi M.December 28, 2021Verified Purchase
Throw Blanket
Zazzle Reviewer Program
I was pleasantly surprised when I received the cotton throw blanket. It was made with such high quality. I am just about to order another throw. The colors are so vibrate and the weaving is so neat. Affordable as well. I really love my throw.
5 out of 5 stars rating
By Leigh F.November 9, 2017Verified Purchase
Throw Blanket
Creator Review
A quality printed throw has its advantages. This is a much finer weave throw than its loopier cousins, and though lighter, it is worth the investment for custom room accessorizing. The back is much prettier than the typical brown, and the fringe on the long sides very vivid, the selvage nicely done. Before photographing, I washed the throw in cold water, delicate, with a thicker woven throw the same size. On tumble dry low, this throw was dry in half the time as the other. This is a very practical quality if you use throws for furniture covers or to wrap up in frequently. The sleekness of the fabric makes it a great layer for accenting or protecting without the feeling of sitting on too much stuff. Perfect for napping or when you feel a light chill coming on. The color printing is beautiful and on this fabric, matched the design and color of my Photoshop image. This is an advantage for blending room fabrics and colors. The fringe on the short sides prints the colors from the design image and therefore varies from the side fringe. I streaked a white fractal line through the plaid pattern to give the illusion of weaving. This printed as crisp as an illusory thread, and put some white in the short side fringe, showing another advantage of print vs loomed- for artistic purposes, line lines, detail, and color integrity can be planned and preserved. My loomed throws have color limitations and more of a needlepoint texture. Print throws reproduce an exact image. The throw felt a little stiff straight out of the package, but this went away in the first delicate wash. Of course I searched the wash water for ink or bleeding and there was none.

Tags

Throw Blankets
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256771172664853319
Created on: 11/18/2017, 12:55 PM
Rating: G