• Events
Tap / click on image to see more RealViewsTM
Sale Price $23.63.  
Original Price $27.80 Comp. value
each
You save 15%

Viking Pattern Blue Tote Bag

Qty:
  1. Style

  2. Size

Other designs from this category

About Totes

Sold by

Style: All-Over-Print Tote Bag, Medium

The classic tote with a modern twist: all-over-print allows for 100% customization, bringing the basic tote to the next level. Your next shopping trip just got a little more earth-friendly and a lot more stylish!

  • Dimensions: 16"l x 16"w; Strap: 28"l
  • Material:
    • Exterior: 100% sturdy brushed polyester
    • Interior: 100% polyester nonwoven laminate
  • 100% cotton web handles
  • Printed then sewn for edge-to-edge designs
  • Black laminated lining for extra support
  • Spot or dry clean only
  • Made in the USA

About This Design

Viking Pattern Blue Tote Bag

Viking Pattern Blue Tote Bag

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating2.3K Total Reviews
2093 total 5-star reviews115 total 4-star reviews18 total 3-star reviews7 total 2-star reviews19 total 1-star reviews
2,252 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Margo O.February 20, 2025 • Verified Purchase
All-Over-Print Tote, Shoulder Tote, Medium
Creator Review
This bag is absolutely beautiful. The print came out great. I have receive compliments about the design.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Margo O.August 4, 2025 • Verified Purchase
All-Over-Print Tote, Shoulder Tote, Medium
Creator Review
I bought this tote bag and water tumbler for a very good friend of mine. I am so happy that everything came out so beautiful! Thank you, Zazzle.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Linda A.May 13, 2018 • Verified Purchase
All-Over-Print Tote, Shoulder Tote, Large
Creator Review
This is so adorable that I gave it to my sister right away. It is her dog on the front and when she saw it I just knew I had to gift it to her. She loves it, we all love it, the quality and color is excellent. She has used it every day since. Looks great, nice and even with good color on the background, very much what I wanted. A real useful and quality product.

Tags

scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256198166661462734
Created on: 7/28/2017, 10:07 PM
Rating: G