Tap / click on image to see more RealViewsTM
Sale Price $20.70.  
Original Price $24.35 Comp. value
per hitch cover
You save 15%

Viking Pattern Blue Trailer Hitch Cover

Qty:
Hitch Cover 2" Receiver

Other designs from this category

About Hitch Cover

Sold by

Size: Hitch Cover 2" Receiver

Let your SUV, RV, truck, or car do the talking with a customized hitch cover! Made in the U.S.A with heavy duty plastic, this cover secures to your receiver with a hitch clip (not included). Your designs, images, and text are printed in full color on a metal plate to make a bold statement wherever you go.

  • Dimensions: 5.125"L x 3.875"W. Available in two sizes to fit the 1.25" (small) or 2" (large) receiver
  • 2" receiver is traditionally for SUV and Pickups; 1.25" receiver typically fits Minivans and smaller cars.
  • Made with heavy duty plastic
  • Secures with hitch clip (not included)
  • Printed in full color on metal plate
  • Proudly made in USA
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 4.7" x 3.5". For best results please add 1/7" bleed.

About This Design

Viking Pattern Blue Trailer Hitch Cover

Viking Pattern Blue Trailer Hitch Cover

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.6 out of 5 stars rating144 Total Reviews
116 total 5-star reviews15 total 4-star reviews4 total 3-star reviews5 total 2-star reviews4 total 1-star reviews
144 Reviews
Reviews for similar products
5 out of 5 stars rating
By Joseph T.April 21, 2024Verified Purchase
Hitch Cover 2" Receiver
This looks amazing on my truck. The artist customized the design for me by adding the red to it to look like the San Diego State football helmet design. Looks perfect on the hitch cover. Even better than expected.
5 out of 5 stars rating
By Alyssa W.June 16, 2021Verified Purchase
Hitch Cover 2" Receiver
Zazzle Reviewer Program
I love the trailer hitch! It looks awesome on my 4RUNNER. Print turned out great! I’m always happy with the print quality of Zazzle products.
5 out of 5 stars rating
By Karen K.December 21, 2023Verified Purchase
Hitch Cover 2" Receiver
Zazzle Reviewer Program
I was able to change the layout on the template to fit various pictures that I wanted to include on this hitch… I love that it was fully customizable. It came faster than expected and photos and text look great. It is made of plastic…but seems substantial enough for everyday use. Photos and text came out just as I had hoped! Love the ability to change text style.

Tags

Hitch Cover
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256460242050496216
Created on: 11/19/2017, 9:55 AM
Rating: G