Tap / click on image to see more RealViewsTM
Sale Price $17.64.  
Original Price $22.05 Comp. value
per mug
You save 20%

Viking Pattern Blue Two-Tone Coffee Mug

Qty:
Two-Tone Mug
-$1.05
+$1.00
+$4.10
+$5.15
+$7.20
+$9.25
Black

Other designs from this category

About Mugs

Sold by

Style: Two-Tone Mug

Add a pop of color to your morning coffee! The outside of the mug features a bright white base for your photo, logo, pattern, or saying, while the inside is vividly glazed in rich color. Give this fun gift to a friend, or add some zest to your dinnerware collection.

  • Available in 11-ounce or 15-ounce
  • Dimensions:
    • 11-ounce: 3.2” D x 3.8" H
    • 15-ounce: 3.4” D x 4.5" H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Viking Pattern Blue Two-Tone Coffee Mug

Viking Pattern Blue Two-Tone Coffee Mug

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating21.5K Total Reviews
19059 total 5-star reviews1829 total 4-star reviews318 total 3-star reviews132 total 2-star reviews199 total 1-star reviews
21,537 Reviews
Reviews for similar products
5 out of 5 stars rating
By Don F.January 7, 2019Verified Purchase
Combo Mug, 11 oz
Zazzle Reviewer Program
The mug itself is a good quality mug but what sets it apart is the vibrant colors and the quality of the printing. Great , printing came out exactly the way it was meant to be with outstanding quality colors.
5 out of 5 stars rating
By Alexandra J.January 19, 2022Verified Purchase
Two-Tone Mug, 15 oz
Creator Review
Perfect size for my morning coffee! 8 oz is definitely not enough to get me going. This 15oz mug is perfect! The handle allows a good grip.... it's the little things ;). Great quality! Black print matches the inside of the mug which adds a nice contrast to the design.
5 out of 5 stars rating
By Robert M.December 4, 2020Verified Purchase
Two-Tone Mug, 11 oz
Zazzle Reviewer Program
I have used this mug for free giveaways for my book publishing company. Clear design and quality shipping. Amazing. Clear and have not faded!

Tags

Mugs
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 168824120322378292
Created on: 12/19/2016, 7:15 PM
Rating: G