Tap / click on image to see more RealViewsTM
Sale Price $16.64.  
Original Price $20.80 Comp. value
per mug
You save 20% ends today

Viking Pattern Blue Two-Tone Coffee Mug

Qty:
Two-Tone Mug
-$1.00
+$0.95
+$3.85
+$4.80
+$7.95
+$12.90
Black

Other designs from this category

About Mugs

Sold by

Style: Two-Tone Mug

Add a pop of color to your morning coffee! The outside of the mug features a bright white base for your photo, logo, pattern, or saying, while the inside is vividly glazed in rich color. Give this fun gift to a friend, or add some zest to your dinnerware collection.

  • Available in 11-ounce or 15-ounce
  • Dimensions:
    • 11-ounce: 3.2” D x 3.8" H
    • 15-ounce: 3.4” D x 4.5" H
  • Microwave and dishwasher safe
  • Use caution when removing the mug from the microwave. Use a pot holder or glove as necessary if it is too hot to the touch. Do not microwave an empty mug
  • Strong, ceramic construction
  • Meets FDA requirements for food and beverage safety
  • Printed on demand in Reno, NV
  • Do not overfill and be careful with hot liquids that may scald
  • Keep out of reach of children when filled with hot liquid

About This Design

Viking Pattern Blue Two-Tone Coffee Mug

Viking Pattern Blue Two-Tone Coffee Mug

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating22.2K Total Reviews
19533 total 5-star reviews1850 total 4-star reviews343 total 3-star reviews157 total 2-star reviews276 total 1-star reviews
22,159 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Alex R.December 22, 2022Verified Purchase
Combo Mug, 15 oz
Zazzle Reviewer Program
The mugs I've designed turned out fabulous. Colors are bright and the colored inside and on handle make the design stand out. As an artist, I'm proud to give these mugs as gifts. The printing is clear, colors in the artwork are brilliant. I'd recommend this to anyone wanting to give a unique gift.
5.0 out of 5 stars rating
5 out of 5 stars rating
By A.August 22, 2022Verified Purchase
Classic Mug, 11 oz
Zazzle Reviewer Program
The design is gorgeous and I love the ability to customize the colors of the mug. I chose the two-tone mug with maroon to complement the design of the flowers and love how it turned out. I only wish I had made the handle colored too (the "combo" mug). Perfect gift for any occasion! The colors of the mug were gorgeous and the print was a decent quality. There was a little speck of gold that didn't print in big block letter of the name but I don't mind. I bought the item on sale (<$10) and for the price I paid I thought the quality was reasonable.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Don F.January 7, 2019Verified Purchase
Combo Mug, 11 oz
Zazzle Reviewer Program
The mug itself is a good quality mug but what sets it apart is the vibrant colors and the quality of the printing. Great , printing came out exactly the way it was meant to be with outstanding quality colors.

Tags

Mugs
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 168824120322378292
Created on: 12/19/2016, 7:15 PM
Rating: G