• Events
Tap / click on image to see more RealViewsTM
Sale Price $6.68.  
Original Price $7.85 Comp. value
per set of 6 labels
You save 15%

Viking Pattern Blue Wine Label

Qty:
  1. Style

Other designs from this category

About Food and Beverage Label Sets

Sold by

Style: Wine Bottle Label

Easily customize a bottle of wine and make it 100% your own by adding a label! Perfect for weddings, bachelor parties, and birthday parties.

  • Dimensions: 3.5" x 4"; fits most standard sized wine bottles
  • Each set includes 6 matte labels
  • Scratch-resistant and waterproof
  • Vibrant, full-color, photo-quality printing that stands the test of time
  • Easy peel-and-stick method; labels are easily applied by removing the crack and peel backing to expose the permanent adhesive
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 3.5" x 4". For best results please add 0.13" bleed.

About This Design

Viking Pattern Blue Wine Label

Viking Pattern Blue Wine Label

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating1.9K Total Reviews
1759 total 5-star reviews81 total 4-star reviews21 total 3-star reviews12 total 2-star reviews43 total 1-star reviews
1,916 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kelly g.September 13, 2023Verified Purchase
Sparkling Wine Bottle Label
Zazzle Reviewer Program
I would recommend this product to anyone that wants to create custom wine labels. The quality is great and comes back to you just how you created it. The quality of printing is top notch.
5.0 out of 5 stars rating
5 out of 5 stars rating
By AnonymousDecember 12, 2025Verified Purchase
Wine Bottle Label
Excellent quality and made beautiful gifts for family, friends and coworkers!!! Will definitely be a regular customer!! Great job ❤️.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Diana C.July 11, 2026Verified Purchase
Wine Bottle Label
These came out so perfect for my niece"s wedding gift favors, love love love them.

Tags

Food and Beverage Label Sets
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256235785226518717
Created on: 11/18/2017, 11:50 AM
Rating: G