Tap / click on image to see more RealViewsTM
Sale Price $6.68.  
Original Price $7.85 Comp. value
per set of 6 labels
You save 15%

Viking Pattern Blue Wine Label

Qty:
Wine Bottle Label (3.5" x 4")
-$1.30
-$2.65
+$5.25
+$5.25
+$5.25
+$5.25
+$5.25

Other designs from this category

About Food and Beverage Label Sets

Sold by

Style: Wine Bottle Label (3.5" x 4")

Easily customize a bottle of wine and make it 100% your own by adding a label! Perfect for weddings, bachelor parties, and birthday parties.

  • Dimensions: 3.5" x 4"; fits most standard sized wine bottles
  • Each set includes 6 matte labels
  • Scratch-resistant and waterproof
  • Vibrant, full-color, photo-quality printing that stands the test of time
  • Easy peel-and-stick method; labels are easily applied by removing the crack and peel backing to expose the permanent adhesive
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 3.5" x 4". For best results please add 0.13" bleed.

About This Design

Viking Pattern Blue Wine Label

Viking Pattern Blue Wine Label

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.9 out of 5 stars rating1.9K Total Reviews
1709 total 5-star reviews82 total 4-star reviews17 total 3-star reviews9 total 2-star reviews33 total 1-star reviews
1,850 Reviews
Reviews for similar products
5 out of 5 stars rating
By M.June 11, 2020Verified Purchase
Sparkling Wine Bottle Labels (4" x 3.5")
Zazzle Reviewer Program
I bought these labels just to add a personal touch to the wine bottles on my wine rack. The color of the labels blend with my color scheme better than the original labels. If you are into monograms, there nothing like your initial or last name on a wine bottle. The print turned out beautifully just as it was in the photo. I only wish I had added a border to the labels just to bring them out a little more.
5 out of 5 stars rating
By B.September 9, 2019Verified Purchase
Sparkling Wine Bottle Labels (4" x 3.5")
Zazzle Reviewer Program
Absolutely loved my champagne bottle labels for my birthday. They arrived in time and were a special touch to all the decorations for my 55 and fabulous party! Label picture print quality was way better than I expected! I highly recommend adding these to any event you have to personalize a bottle :)
5 out of 5 stars rating
By Enid R.February 1, 2021Verified Purchase
Wine Bottle Label (3.5" x 4")
Zazzle Reviewer Program
Hi. I appreciate so much that Zazzle send me my order by special delivery. I never forget that you make possible that my husband received his wine bottles with the stickers today, on his 70 birthday. Thank you so much. I love ZAZZLE!❤️ ENID Sent from my iPhone On Jan 30, 2021, at 7:31 AM, Zazzle <notifications@zazzle.com> wrote: . EVERYTHING WAS PERFECT!!!! THANKS FOR ALL!!!!!!!!!

Tags

Food and Beverage Label Sets
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256235785226518717
Created on: 11/18/2017, 11:50 AM
Rating: G