Tap / click on image to see more RealViewsTM
Sale Price $18.12.  
Original Price $21.30. Comp. value
Sale Price $3.02per sheet of tissue paper.
You save 15%

Vintage French Poster Cats Girl Milk Tissue Paper

Qty:

Other designs from this category

About Tissue Paper

Sold by

Size: 14" x 20"

Customize your own creative tissue paper for gift wrapping. You can add something simple like the recipients’ name, or get fancy by adding a cool design, photo, image, or artwork for a one-of-a-kind look. Add pizazz to any present!

  • Please note that this size tissue arrives folded
  • Dimensions: 14” l x 20” w unfolded (14" l x 10" w folded)
  • Full color edge-to-edge print
  • 10lb paper is great for wrapping jewelry, small gifts and party favors
  • 18lb paper is thicker than standard tissue paper and provides more padding for delicate or heavier items
  • Allows for easy stuffing
  • Not intended for food contact use

About This Design

Vintage French Poster Cats Girl Milk Tissue Paper

Vintage French Poster Cats Girl Milk Tissue Paper

Darling French vintage Lait Pur de la Vingeanne Sterilise Art Print by Théophile Alexandre Steinlen, with Cats at the foot of a Girl drinking Milk, is on this Tissue Paper. Image is public domain due to expired copyright.

Customer Reviews

4.8 out of 5 stars rating2.8K Total Reviews
2567 total 5-star reviews146 total 4-star reviews47 total 3-star reviews25 total 2-star reviews45 total 1-star reviews
2,830 Reviews
Reviews for similar products
5 out of 5 stars rating
By Babcia K.March 24, 2026Verified Purchase
Custom 10lb Tissue Paper, Size: 10" x 14"
What a gorgeous pattern! Struggled a bit on match for multiple sheets required to cover the drop leaf table, but happy with result! Paper stayed true to color, the 18 lb weight is easy to work with, Art as Furniture - love it.
5 out of 5 stars rating
By Tracey G.March 8, 2024Verified Purchase
Custom 18lb Tissue Paper, Size: 10" x 14"
Love this paper I’ve been looking for something like this for a while now and it’s perfect I love the colors. I love this print I put two of the same papers together because my project was a bit bigger than the papers I ordered, but it turned out absolutely beautiful. I love it.
5 out of 5 stars rating
By Babcia K.January 30, 2024Verified Purchase
Custom 18lb Tissue Paper, Size: 21" x 29"
Zazzle Reviewer Program
Easy to work with, the colors were as shown online, the weight of the paper was nice. I turned an old refrigerator box into a bookshelf in a guest bedroom / reading room. The paper went on clean, the ink did not run when finish was applied. I love the way it turned out! Sharp, no muddied spots

Tags

Tissue Paper
tissue papervintage tissue papervintagefrenchcatsgirlmilkephemerakittiespets
All Products
tissue papervintage tissue papervintagefrenchcatsgirlmilkephemerakittiespets

Other Info

Product ID: 256007565250066876
Created on: 9/7/2019, 6:08 AM
Rating: G