Tap / click on image to see more RealViewsTM
Sale Price $1.69.  
Original Price $1.98 Comp. value
per postcard
You save 15%

Vintage Italy Italian Map Travel Postcard

Qty:
Signature Matte
18 pt thickness / 120 lb weight Soft white, soft eggshell texture
-$0.18

Other designs from this category

About Postcards

Sold by

Size: Standard Postcard

Create your own vacation-worthy postcard! Any view you’ve seen, any monument you’ve fallen in love with, can all be added to your postcard with our personalization tool.

  • Dimensions: 5.6" L x 4.25" H; qualified USPS postcard size
  • High quality, full-color, full-bleed printing on both sides

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Vintage Italy Italian Map Travel Postcard

Vintage Italy Italian Map Travel Postcard

Anyone would love to receive this vintage Italia travel postcard featuring a map of Italy with flowers and bees! Your recipient will appreciate the floral and Italian architecture motif of this postcard!

Customer Reviews

4.9 out of 5 stars rating15.7K Total Reviews
14308 total 5-star reviews999 total 4-star reviews197 total 3-star reviews68 total 2-star reviews114 total 1-star reviews
15,686 Reviews
Reviews for similar products
5 out of 5 stars rating
By Ray A.September 30, 2025Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Very pleased with my order. All my prints were manufactured to a very high standard to my exact specifications and edited additions.
5 out of 5 stars rating
By Paul I.February 4, 2021Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Creator Review
I had never seen these classic science fiction images and most of my friends have not seen them either. They are like little treasures! Amazing quality and fun to send people!
5 out of 5 stars rating
By Jennifer W.November 28, 2022Verified Purchase
Post Card, Size: Standard Postcard, Paper: Signature Matte, Envelopes: None
Zazzle Reviewer Program
I joined Postcrossing a few months ago and wanted postcards to represent my state well. I found them on Zazzle. I purchased numerous cards and was impressed with all of them. Excellent! The colors are beautiful. The cards have the exact look I wanted. I couldn't be happier.

Tags

Postcards
italyvintagemaptravelitalianitaliafloralflowersbeesarchitecture
All Products
italyvintagemaptravelitalianitaliafloralflowersbeesarchitecture

Other Info

Product ID: 256641283317229366
Created on: 10/9/2021, 5:01 AM
Rating: G