• Events
Tap / click on image to see more RealViewsTM
$34.15
per hat
 

War Dog Embroidered Baseball Cap

Qty:
  1. Size

  2. Style

  3. Color: Light Olive

Other designs from this category

About Embroidered Hats

Sold by

Style: Distressed Adjustable Cap

If you like the lived-in look, you'll love this enzyme-washed hat from District Threads. Comfortable as an old friend, it's 100% cotton and has an unstructured style with 6 panels and a low profile. Make it the perfect size with the metal D-ring slider buckle and hideaway cloth strap.

  • 100% cotton twill
  • Decoration style: digital embroidery
  • Low profile and unstructured
  • Metal D-ring slider buckle with hideaway strap closure
  • Due to a special finishing process, distress and color may vary
  • Care Instructions : Machine wash cold. Non-chlorine bleach, when needed. Tumble dry medium. Do not iron decorations/customization.

For some design guidance please see: How Do I Create a Design Suitable for Zazzle Embroidery

About This Design

War Dog Embroidered Baseball Cap

War Dog Embroidered Baseball Cap

Dogs have been used in warfare since ancient times. Canines have a long history of aiding human beings in their wars against each other. Although dogs are not as widely used in modern warfare as they once were, a new breed of 'war dogs' no exist. Men. Trained to be effective in combat just as they are as scouts, sentries and trackers, men have evolved to be the most formidable killing machines in existence. Men are the new 'war dogs.'

Customer Reviews

4.7 out of 5 stars rating1.2K Total Reviews
955 total 5-star reviews137 total 4-star reviews41 total 3-star reviews9 total 2-star reviews12 total 1-star reviews
1,154 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Innocent P.October 1, 2021Verified Purchase
Embroidered Hat, Distressed Adjustable Cap
Zazzle Reviewer Program
It's super durable and the embroidery hasn't frayed or ripped at all! It's also adjustable in size! Super amazing. Hasn't come off or anything.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Stephen L.November 1, 2015Verified Purchase
Embroidered Hat, Basic Adjustable Cap
Zazzle Reviewer Program
Excellent quality hat. Love Yahuwah in Paleo Hebrew with white letters! Great stitch work, sturdy, durable hat. I really like the Scotland Blue color and the Distressed Chino is 100% Cotton! Looks great! The design and quality were excellent.
5.0 out of 5 stars rating
5 out of 5 stars rating
By b.January 14, 2013Verified Purchase
Embroidered Hat, Distressed Adjustable Cap
Zazzle Reviewer Program
I bought this hat for my husband's Christmas present. It didn't arrive in a timely fashion, but it did make it. He loved it. It was just what he wanted. The embroidery turned out nice!

Tags

war dogwardogswarfaremilitaryparamilitarycombatantspecial forcesarmed forcescool

Other Info

Product ID: 233805830113726878
Created on: 6/8/2018, 10:29 AM
Rating: G