Tap / click on image to see more RealViewsTM
Sale Price $8.55.  
Original Price $9.50 Comp. value
per sticker
You save 10%

watercolour world map RV - STICKER

Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 6" x 6" Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 6" L x 6.5" W
  • Design Area: 6" L x 6" W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.125" border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

watercolour world map RV - STICKER

watercolour world map RV - STICKER

STICKER VANLIFE, motorhome, van, travel, traveling, adventure, explore, map, world, country, campervan, watercolour, holiday, travels, exploring, traveler, travellife, life, living, cartoon, digitalart, rv, caravan, kombi, homeonwheel, explorer, watercolour, color, nomad, earth, vacation, vaner, wonderlust, wonderluster, worldmap, travelblog, getaway, exploringtheglobe, roadtrip, tourist, worldnomad, sticker, bumpersticker

Customer Reviews

4.7 out of 5 stars rating3 Total Reviews
2 total 5-star reviews1 total 4-star reviews0 total 3-star reviews0 total 2-star reviews0 total 1-star reviews
3 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lawana H.January 24, 2026Verified Purchase
This turned out great!!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Lawana H.April 21, 2026Verified Purchase
It turned out amazing!!! Love this!!!!
4.0 out of 5 stars rating
4 out of 5 stars rating
By Amy H.May 28, 2020Verified Purchase
8" x 8" Sheet Custom-Cut Vinyl Stickers, Glossy Transparent
Creator Review
Put Sticker on a Planner! It looks nice. No fade. good qaulity printing.

Tags

Custom-Cut Vinyl Stickers
motorhomestickertravelvanlifecampervancaravanroadtripworld mapmapholiday
All Products
motorhomestickertravelvanlifecampervancaravanroadtripworld mapmapholiday

Other Info

Product ID: 256688614948988576
Created on: 5/1/2019, 6:45 AM
Rating: G