• Events
Tap / click on image to see more RealViewsTM
Sale Price $14.24.  
Original Price $16.75 Comp. value
per sticker
You save 15%

Wedding individual guest names script labels

4.0 out of 5 stars rating
206 Total Reviews
|
by
Qty:
  1. Sticker Sheet Size

  2. Paper Type

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 14" x 14" Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 14" L x 14.5" W
  • Design Area: 14" L x 14" W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.125" border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Wedding individual guest names script labels

Wedding individual guest names script labels

Simple elegant custom wedding 24 guest name labels with a chic black and white classic handwriting calligraphy script.

Customer Reviews

4.0 out of 5 stars rating206 Total Reviews
140 total 5-star reviews11 total 4-star reviews10 total 3-star reviews11 total 2-star reviews34 total 1-star reviews
206 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Aurelia T.May 5, 2022Verified Purchase
14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was able to give us a designer the dimensions of my mini shot glasses and she was able to reduce all the labels onto one sheet we’re all I did was going to change the names and add the table number for my seating chart absolutely perfect. Simple perfect easy to read fit great on my jar
5.0 out of 5 stars rating
5 out of 5 stars rating
By Nichole M.August 9, 2020Verified Purchase
8" x 8" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
These turned out so beautifully and all our guests loved them!! They did not have the orange suit sleeves so I ordered them separately and they fit perfectly into the mailing envelope. I had an issue with the address labels not being ledge able and they redid them and replaced them. They are perfect!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Phil T.February 26, 2021Verified Purchase
4" x 4" Sheet Custom-Cut Vinyl Stickers, Glossy Clear
Zazzle Reviewer Program
Good quality, does not tear and rolls off the surface easily. Needed to reposition a lot, glue held its own. Awesome. I would recommend.

Tags

guest names wedding stickersblack and whitestylishsimplescriptindividual names for place cardhandwriting calligraphy24 wedding guest names labelselegantclassic

Other Info

Product ID: 256818840828089474
Created on: 5/13/2026, 10:55 PM
Rating: G