Tap / click on image to see more RealViewsTM
Sale Price $27.84.  
Original Price $32.75 Comp. value
per banner ornament
You save 15%

White, Pirate Flag Calico Jack, Skull & Cutlass Silver Plated Banner Ornament

Qty:
Silver Tone

Other designs from this category

About Banner Ornaments

Sold by

Color: Banner Ornament - Silver Tone

Make the holiday’s special for you and your family with one of our banner ornaments. Capture fun, romantic, or beautiful moments forever by adding a picture, design, or message to hang every holiday season.

  • Dimensions: 2.4" l x 1.95" w; thickness: .08"
  • Sterling silver colored metal ornament
  • Fade-proof print sealed with a UV-resistant coating
  • Silver ribbon included

About This Design

White, Pirate Flag Calico Jack, Skull & Cutlass Silver Plated Banner Ornament

White, Pirate Flag Calico Jack, Skull & Cutlass Silver Plated Banner Ornament

A low growl rumbled across the waves, not from the storm brewing on the horizon, but from Captain Jack's throat. His dark eyes, usually gleaming with mischief, held a steely glint as he surveyed the approaching ship. The "Revenge," his sloop, heeled slightly in the choppy water, its black hull a stark contrast to the dawn's pale light. --- "Spanish merchantman, by the looks of it," rasped Old Bill, the grizzled bosun, his weathered face etched with years at sea. "Fat belly, ripe for the plucking." --- A slow smile spread across Jack's face, as cold and sharp as the cutlass hanging from his hip. Unlike other captains who reveled in open brawls, Jack preferred a more theatrical approach. He wasn't interested in just plunder; he craved the delicious terror that preceded it. --- "Hold the sails, lads," he called out, his voice surprisingly calm amidst the rising tension. "Let them get a good look at us." --- The crew, a motley bunch of cutthroats and dreamers, exchanged knowing glances. This wasn't their first rodeo. Below deck, the nimble powder monkeys scurried about, ensuring a smooth flow of ammunition, while the gunners readied their cannons with practiced ease. --- The unsuspecting merchant ship, the "El Dorado," drew closer, its white sails catching the first rays of the hesitant sun. A band of musicians played a cheerful tune, a stark contrast to the grim silence aboard the "Revenge." --- Suddenly, with a flourish, Jack raised a hand. The tattered French flag they'd been flying dipped down, revealing a sight that sent shivers down the spines of even the most hardened pirates; the Jolly Roger. Its stark white skull, leering with empty sockets, seemed to mock the approaching vessel. Below the skull, crossed cutlasses gleamed with a deadly promise. --- A collective gasp echoed from the "El Dorado." The music died down, replaced by an awful, suffocating silence. The festive air vanished, replaced by a thick fog of terror. Even the seasoned sailors of the "El Dorado" couldn't help but flinch at the sight of the infamous flag. --- Jack allowed the silence to stretch, savoring the fear that radiated from the other ship like heat waves. Then, a slow, cruel smile spread across his face. "See, lads," he drawled, his voice dripping with mock sympathy, "sometimes the best weapon is a good scare." --- The element of surprise, meticulously orchestrated by Jack, had done its job. The pirates of the "Revenge" might not have fired a single shot yet, but the battle was already half-won. The legend of Calico Jack and his fearsome Jolly Roger would echo through the Caribbean for years to come, a chilling reminder that sometimes, the most terrifying weapon is a symbol. --- This file is made by RootOfAllLight available under the Creative Commons CC0 1.0 Universal Public Domain Dedication

Customer Reviews

4.2 out of 5 stars rating23 Total Reviews
17 total 5-star reviews1 total 4-star reviews1 total 3-star reviews1 total 2-star reviews3 total 1-star reviews
23 Reviews
Reviews for similar products
5 out of 5 stars rating
By B.December 20, 2025Verified Purchase
Banner Ornament - Silver Tone
Looks great. waiting for delivery before xmas.
5 out of 5 stars rating
By Isabelle L.February 16, 2023Verified Purchase
Banner Ornament - Silver Tone
Creator Review
I bought these for family members that I took to Yellowstone over the summer, They all loved them, It's small, but still shows how powerful Old Faithful truly is. Clear and beautiful.
5 out of 5 stars rating
By sabrina s.December 30, 2022Verified Purchase
Banner Ornament - Gold Tone
Zazzle Reviewer Program
This is a fabulous ornament to have made for that special person in your life. I made mine with a picture of my mom and sister and gave them as Christmas gifts. They both loved them and we all now have the matching ornaments. I would highly recommend! Clear and crisp printing!

Custom Made Easy

  • Step 1: Choose your favorite design.

    Step 1:

    Choose your favorite design.

  • Step 2: Select your desired size, shape and paper type

    Step 2:

    Select your desired shape and material

  • Step 3: Click 'Personalize' to enter your custom text and images.

    Step 3:

    Click 'Personalize' to enter your custom text and images.

  • Step 4: When finished customizing your card, click 'Done' to see your final product!

    Step 4:

    When finished customizing, click 'Done' to see your final product!

Tags

Banner Ornaments
skullskullsswordscalico jackjohn rackhampirateflagpiracyraiderhigh seas
All Products
skullskullsswordscalico jackjohn rackhampirateflagpiracyraiderhigh seas

Other Info

Product ID: 256751386456978406
Created on: 8/10/2022, 1:13 AM
Rating: G