Tap / click on image to see more RealViewsTM
Sale Price $8.24.  
Original Price $9.15 Comp. value
per set of 3 sheets
You save 10%

winter flakes holidays motif wrapping paper sheets

Collection
Qty:

Other designs from this category

Shop this collection

Rodica Ichim
snowflake partyDesigned by Rodica Ichim
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 

About Wrapping Paper Sheet Sets

Sold by

Size: 19" x 29"

Our beautifully printed wrapping paper comes in a set of three conveniently pre-cut sheets. Ideal for gift wrapping, party favors, or making your next creative DIY crafting project really stand out! These flat wraps are better than traditional rolls of wrapping paper because they don't roll back on themselves, and the convenient guideline grids on the back of each and every sheet allows you to effortlessly line up your gifts on them, and then make a perfect fold every time. And because they are flat and easy to store, they are ideal for those last-minute presents - say goodbye to pulling those old fashioned crushed and ruined paper rolls out of the closet!

  • Sold in sets of 3
  • Each sheet is customizable! Mix and match designs to create unique combinations
  • Dimensions: (3) 19.5" x 28.5" sheets
  • Printed on heavyweight 70 lb. uncoated matte or 80 lb. semi-gloss paper
  • Back side features grid guidelines for precise wrapping
  • Use individually or together for a creative gift presentation
  • Lay flat edges make these sheets ideal for DIY crafts and projects, such as decoupage, matting, or even scrapbooking
  • Sheets come loosely rolled, and are crease-free

About This Design

winter flakes holidays motif wrapping paper sheets

winter flakes holidays motif wrapping paper sheets

ice flakes winter holidays motif

Customer Reviews

4.8 out of 5 stars rating1.1K Total Reviews
1000 total 5-star reviews48 total 4-star reviews19 total 3-star reviews4 total 2-star reviews26 total 1-star reviews
1,097 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By C L.November 8, 2021Verified Purchase
19" x 29" Wrapping Paper Sheets, Matte
Zazzle Reviewer Program
This is a great heavy weight paper. No peeking through with this paper. Grid lines on the back for clumsy cutters like me. Designs are pretty but larger than I expected. Printing quality is great. As is the blue color…..I just love it!!
5.0 out of 5 stars rating
5 out of 5 stars rating
By Victoria B.December 27, 2020Verified Purchase
19" x 29" Wrapping Paper Sheets, Matte
Creator Review
I am extremely satisfied with my product. Everyone that received a gift wrapped with these design loved the customized wrapping paper. The printing turned out well.
5.0 out of 5 stars rating
5 out of 5 stars rating
By jasmine p.January 10, 2026Verified Purchase
19" x 29" Wrapping Paper Sheets, Matte
I absolutely loved this wrapping paper! The material was thick but still smooth, which made it easy to wrap and feel very high quality. The picture I uploaded came out perfect and looked so cute — the print quality exceeded my expectations. It arrived just in time for Christmas, and my whole family loved it. I will definitely be ordering again. Such a fun and special touch for gifts!

Tags

Wrapping Paper Sheet Sets
wintersnowflakeschristmaspatterngreywhiteholidays
All Products
wintersnowflakeschristmaspatterngreywhiteholidays

Other Info

Product ID: 256145392692077870
Created on: 10/1/2022, 11:51 PM
Rating: G