Tap / click on image to see more RealViewsTM
Sale Price $7.10.  
Original Price $8.35 Comp. value
per sheet of 20
You save 15%

Winter Snowflake Christmas sticker

Qty:

Other designs from this category

About Stickers

Sold by

Shape: Classic Round Stickers

Create custom stickers for every occasion! From special mailings and scrapbooking to kids' activities and DIY projects, you'll find these stickers are great for so many uses. Add your own designs, patterns, text, and pictures!

  • Dimensions: Available in 2 sizes:
    • Large: 3" diameter, 6 stickers per sheet
    • Small: 1.5" diameter, 20 stickers per sheet
  • Printed on white acid-free paper
  • Vibrant full-color, full-bleed printing
  • Scratch-resistant front, easy peel-and-stick back
  • Available in a matte or glossy finish
  • Choose between a variety of different shapes

About This Design

Winter Snowflake Christmas sticker

Winter Snowflake Christmas sticker

Featuring a beautifully detailed snowflake and the classic message “Merry Christmas,” this design brings seasonal charm to gift bags, wrapped presents, envelopes, party favors, and holiday packaging. The crisp winter motif and clean typography make it perfect for both modern and traditional Christmas themes. Whether you’re personalizing family gifts, creating custom holiday treats, or adding a professional touch to handmade items, these stickers make your presents look extra special. A simple, stylish, and joyful way to share the spirit of the season! Perfect for: 🎁 Gift wrapping ❄️ Holiday party favors 📦 Small business packaging 💌 Christmas cards & envelopes Spread cheer with every gift you give!

Customer Reviews

4.8 out of 5 stars rating26.1K Total Reviews
22674 total 5-star reviews2157 total 4-star reviews508 total 3-star reviews288 total 2-star reviews433 total 1-star reviews
26,060 Reviews
Reviews for similar products
5 out of 5 stars rating
By AnonymousOctober 19, 2025Verified Purchase
Custom Classic Round Stickers, Format: Sheet of Stickers, Size: Small, 1½ inch (sheet of 20), Paper Type: Glossy White Paper
I have reordered these now 3 times for my small business because they come in so fast and the quality is just absolutely unmatched. Will continue to repurchase for a LONG time!
5 out of 5 stars rating
By Kathleen M.April 29, 2024Verified Purchase
Custom Classic Round Stickers, Format: Sheet of Stickers, Size: Small, 1½ inch (sheet of 20), Paper Type: Glossy White Paper
These were easy to order and came well ahead of the date. They are high qualify labels that peel easily and looked as advertised online. These labels perfectly matched with the "rustic" theme for my niece's bridal shower. I made "cowgirl cookies" and put these labels on the jars. Everyone loved the jars!
5 out of 5 stars rating
By Barbara M.March 25, 2023Verified Purchase
Custom Classic Round Stickers, Format: Sheet of Stickers, Size: Large, 3 inch (sheet of 6), Paper Type: Glossy White Paper
Zazzle Reviewer Program
This product is made of a durable material that sticks to my boutique bags easily. The product is shiny so my customers notice it. This product gets a 5 out of 5! I love it! The printing is perfect and the design I chose almost looks like glitter at the top. What a great addition to my boutique bags! Now customers are reminded where they shopped and might come back to shop with me again at Crystal Threads. The print quality is a 5 out of 5, and looks beautiful!

Tags

Stickers
giftwrappingchristmasstickertagsnowflakemerryhoildayredsnowflakes
All Products
giftwrappingchristmasstickertagsnowflakemerryhoildayredsnowflakes

Other Info

Product ID: 256743275812021445
Created on: 12/7/2025, 2:43 PM
Rating: G