Tap / click on image to see more RealViewsTM
Sale Price $25.40.  
Original Price $31.75 Comp. value
per wall decal
You save 20% ends today

Yes Chess is a Sport Funny Chess Lovers Gift Wall Decal

Qty:
12" x 12"

Other designs from this category

About Wall Decals

Sold by

Print Process: Opaque Design: All-over White Underbase

Art is printed on a white sheet of plastic making colors look very dynamic. Please note that the white sheet is opaque.

Shape: Custom Cut

Wall Decals can be easily applied, removed, and repositioned without leaving damage or a sticky residue. They can be used on walls or any other smooth surface like - Mirrors, Doors, Drawer Cabinets and more. Wall decals are perfect for branding, decoration and promotions. These decals are not designed to stick on rough or uneven surfaces such as stucco, cinder block, and brick.

  • Reusable design is safe for walls
  • Sticks to most smooth, flat surfaces
  • No tape or tacks required

About This Design

Yes Chess is a Sport Funny Chess Lovers Gift Wall Decal

Yes Chess is a Sport Funny Chess Lovers Gift Wall Decal

chess,board,horse,pawn,gift,player,checkmate,king,queen,funny

Customer Reviews

3.4 out of 5 stars rating5 Total Reviews
3 total 5-star reviews0 total 4-star reviews0 total 3-star reviews0 total 2-star reviews2 total 1-star reviews
5 Reviews
Reviews for similar products
5 out of 5 stars rating
By Sharon R.February 26, 2023Verified Purchase
Wall Decal, Size: 18.00" x 18.00", Style: Opaque Design: All-over White Underbase, Shape: Rectangle
Zazzle Reviewer Program
We got this for my husband's school cafeteria wall. We needed something that would be safe to the wall paint and cover a lot of wall space. Because it was a large decal, it was a bit tricky to put up - took 2 people, but it was simple enough to do. The team was able to lift up the corner and re-place it to get a smooth look. Printing was crisp and clear and the lines were level.
5 out of 5 stars rating
By PAM M.September 20, 2023Verified Purchase
Wall Decal, Size: 24.00" x 24.00", Style: Opaque Design: All-over White Underbase, Shape: Rectangle
Zazzle Reviewer Program
I love it. I acutally used on a wall of office. Zazzle was the only site i found where i could make a word cloud out of mulitple colors. I was able to use the company colors and slogans. I kept reshuffling until i really liked the way it looked and then ordered Very easy and it looks great on the wall. Applying the floordecal with a squeeqie was very easy. Love It . Get a lot of compliments on it. Brillant all colors showing up great
5 out of 5 stars rating
By Jennifer H.August 25, 2022Verified Purchase
Wall Decal, Size: 12.00" x 12.00", Style: Automatic Opaque Design: White Underbase, Shape: Custom Cut
Creator Review
I am very impressed by the quality of these wall stickers. I created this for my daughter who is always dancing in her kitchen. Can't wait to give it to her. Very satisfied with image quality.

Tags

Wall Decals
chessboardhorsepawngiftplayercheckmatekingqueenfunny
All Products
chessboardhorsepawngiftplayercheckmatekingqueenfunny

Other Info

Product ID: 256527687047332227
Created on: 7/8/2022, 5:08 PM
Rating: G