Tap / click on image to see more RealViewsTM
Sale Price $54.00.  
Original Price $60.00. Comp. value
Sale Price $0.54per candy.
You save 10%

Young Wild Tiger Hershey®'s Kisses®

Qty:
Gold (with Almonds)

Other designs from this category

About Hershey's Candy Favorss

Sold by

Style: Hershey®'s Kisses®

These mouthwatering little drops of goodness have been putting a smile on people's faces since 1907, over one hundred years of sugary sweetness! Sprinkle Hershey®'s Kisses® on tables to add sparkle to your occasion or arrange Kisses® in unique vases or bowls and use as centerpieces. However you choose to spread these little favors make sure you have enough… after all one kiss is NEVER enough!

  • Proudly made in the USA
  • Great For Gifts and Favors
  • The Sweetest Favors for your Special Day
  • Easily self assembled with self-adhesive labels
  • Purchase pre-assembled for an upcharge
  • Gold foil Hershey's Kisses contain almonds
  • Dimensions: 0.875" dia. x 1"h
  • Suggested quantity per guest: 5-10 kisses
  • Choose from a variety of foil colors
  • Kosher ⓊD
  • Store at room temperature
  • Allergy Information: Gold foil Hershey's Kisses contain almonds. For complete information regarding any Hershey's products, please contact The Hershey Company

Nutrition Facts
about 50 servings per container
Serving size 7 pieces (32g)
Amount per serving
Calories 160
Total Fat
9g, 12% (% Daily Value*)
Saturated Fat 6g, 29%
Trans Fat 0g
Cholesterol 10mg, 3%
Sodium 25mg, 1%
Total Carbohydrate 19g, 7%
Dietary Fiber <1g, 3%
Total Sugars 18g
Includes 16g Added Sugars, 31%
Protein 2g

Vitamin D 0.5mcg, 2%
Calclum 60mg, 4%
Iron 1.2mg, 6%
Potassium 120mg, 2%

The % Daily Value tells you how much a nutrient in a serving of food contributes to a daily diet. 2,000 calories a day is used for general nutrional advice.

INGREDIENTS: MILK CHOCOLATE| SUGAR; MILK CHOCOLATE; COCOA BUTTER, MILK FAT; LECITHIN (SOY): NATURAL FLAVOR)

GLUTEN FREE

About This Design

Young Wild Tiger Hershey®'s Kisses®

Young Wild Tiger Hershey®'s Kisses®

Beautiful young wild tiger face Kisses. Ideal for party favor, birthday, graduation and more.

Customer Reviews

3.9 out of 5 stars rating64 Total Reviews
36 total 5-star reviews9 total 4-star reviews4 total 3-star reviews4 total 2-star reviews11 total 1-star reviews
64 Reviews
Reviews for similar products
5 out of 5 stars rating
By Elizaverg G.April 29, 2024Verified Purchase
came out super cute for a favor for my wedding! clear and vibrant colors
5 out of 5 stars rating
By Dana B.August 13, 2023Verified Purchase
Hershey®'s Kisses® Candy Favors, Non-Assembled
Zazzle Reviewer Program
These personalized Kisses are the perfect add to my son's wedding guest gift boxes! They arrived on time packed in a styrofoam cooler with with an ice pack, alleviating my worries of not being home to bring them inside immediately from the Oklahoma summer heat! Thank you, Zazzle! Perfect image of the picture I uploaded of the bride and groom!
1 out of 5 stars rating
By Kelsee C.June 20, 2024Verified Purchase
Hershey®'s Kisses® Candy Favors, Non-Assembled
I ordered these for my blueberry themed baby shower which is only 9 days away. They seemed to be packaged well but after I pulled the bag out of the package I’m finding holes in the wrappers. Without opening the bag they were shipped in I took pictures, it was very obvious that more than half of the candy has a ripped wrapper or is already opened on the top. I can not serve my guests half opened candy, do not waste your money on this product. The labels however are beautiful and I’m now wishing I purchased only labels for the kisses and bought my own candy at walmart. .

Tags

Hershey's Candy Favorss
birthdaypartytigerfelineanimalwildwildlifeyoung tigerwild tigercute
All Products
birthdaypartytigerfelineanimalwildwildlifeyoung tigerwild tigercute

Other Info

Product ID: 256995958341186835
Created on: 10/21/2023, 3:13 PM
Rating: G