Caduceus (Back)Caduceus (Standing Front)Caduceus (Front/Back)
Caduceus (Front)
Sale Price $2.59.  
Original Price $3.70 Comp. value
per card
You save 30%

Caduceus

4.7 out of 5 stars rating
2327 Total Reviews
| by AURA-HYSTERICA
View Product Details

Popular from this Department

About Flat Cards

Sold by

Size: 4" x 9"

Stand out with custom flat cards, turn this flat card into anything imaginable.

  • Dimensions: 4" x 9" (portrait or landscape)
  • High-quality, full-color, full-bleed printing
  • Print on both sides for no additional cost
  • Add personal photos and text for free

Paper Type: Basic Semi-Gloss

Bright, smooth, and polished—our Basic Semi-Gloss paper brings your design to life with vibrant color and a subtle shine. It’s the perfect choice for everyday elegance and budget-friendly celebrations.

  • Made in Italy, printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Caduceus

Caduceus

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating2.3K Total Reviews
2027 total 5-star reviews154 total 4-star reviews40 total 3-star reviews28 total 2-star reviews78 total 1-star reviews
2,327 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Sabrina J.September 12, 2025Verified Purchase
Flat Card, Size: 3.5" x 5", Paper: Basic Semi-Gloss, Corner: Squared, Envelopes: No Envelopes, Print Quality: Standard
Great quality product. Not thin or flimsy at all !! Super fast production and super fast ship even without rush shipping. Great seller. Definitely ordering more items ! .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Margo O.August 8, 2024Verified Purchase
Flat Card, Size: 5.25" x 5.25", Paper: Signature Matte, Corner: Squared, Envelopes: Blank White Envelopes, Print Quality: Standard
Creator Review
When I received these Save-the-date card, I was excited see how pretty it is. Elegant floral wedding design. The print came out perfect.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Suzi G.December 10, 2025Verified Purchase
Flat Card, Size: 4.25" x 5.5", Paper: Signature Matte, Corner: Squared, Envelopes: Blank White Envelopes, Print Quality: Standard
I'm so excited for my Mom to get this Card!!! Thank you to the Creator for these beautiful lilies, they're so pretty! Moms favorite flower 🤗👍.

Tags

Flat Cards
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 245343749875724602
Created on: 4/25/2010, 1:54 PM
Rating: G