• Events
Tap / click on image to see more RealViewsTM
Sale Price $18.56.  
Original Price $23.20 Comp. value
per pack of 50
You save 20%

Caduceus Business Card

Qty:
  1. Size

  2. Corner Style

  3. Paper

Other designs from this category

About Business Cards

Sold by

Size: 3.5" x 2.0"

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 3.5" x 2.0"
  • Full color CMYK print process
  • Double sided printing for no additional cost

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust color and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection
  • Made and printed in the USA

About This Design

Caduceus Business Card

Caduceus Business Card

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating40.4K Total Reviews
33417 total 5-star reviews3886 total 4-star reviews1108 total 3-star reviews740 total 2-star reviews1278 total 1-star reviews
40,429 Reviews
5.0 out of 5 stars rating
5 out of 5 stars rating
By nameApril 7, 2015Verified Purchase
Business Cards Pack of 50, Size: 3.5" x 2.0",Paper: Signature UV Matte, Corners: Squared
Zazzle Reviewer Program
Gold Business Cards Stand Out !!! Easy to locate among the others. printing is great!!!!
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Matty W.January 5, 2021Verified Purchase
Business Cards Pack of 50, Size: 3.5" x 2.0",Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
I love to surprise my wife with notes. I make these so I can keep them in my wallet and place them anywhere when I feel she needs a little surprise. I usually hide them somewhere for her to find in her pocket or in her car to brighten her morning before work. This is my 8th or so iteration after a few years of making them and these are my favorite. The printing turned out perfect and spot on. Sometimes the cutting can be ever so slightly off but this time it was perfect. Just make sure to follow the guide and use references that have some grace space on the edges. That is key.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kimberly W.March 27, 2023Verified Purchase
Business Cards Pack of 50, Size: 2.5" x 2.5",Paper: Standard Semi-Gloss, Corners: Rounded
Zazzle Reviewer Program
These were used for earring cards for my small business and were absolutely amazing. The quality is superb. Very beautiful and gave my product a professional look.

NEW! Premium Business Cards

Foil. Spot UV. Plastic. Find the finish that fits your brand.

Shop Now

Why Shop on Zazzle

  • why zazzle
  • why zazzle

Tags

caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 240912045309499135
Created on: 4/25/2010, 1:11 PM
Rating: G