Tap / click on image to see more RealViewsTM
Sale Price $22.96.  
Original Price $32.80 Comp. value
per pack of 100
You save 30% ends today

Caduceus Business Card

Qty:
Squared
+$5.35
Signature UV Matte

18 pt thickness / 325 GSM
Bright white, matte finish

-$5.30
-$5.30
+$5.30
+$5.30
+$5.30
+$5.30
+$5.30
+$5.30
+$14.80

Other designs from this category

About Business Cards

Sold by

Size: Standard, 3.5" x 2.0"

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 3.5" x 2.0"
  • Full color CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust color and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection
  • Made and printed in the USA

About This Design

Caduceus Business Card

Caduceus Business Card

Design that makes caduceus motif

Customer Reviews

4.7 out of 5 stars rating38.1K Total Reviews
31958 total 5-star reviews3781 total 4-star reviews945 total 3-star reviews568 total 2-star reviews834 total 1-star reviews
38,086 Reviews
5 out of 5 stars rating
By n.April 7, 2015Verified Purchase
Business Card, Size: Standard, 3.5" x 2.0",Paper: Signature UV Matte, Corners: Squared
Zazzle Reviewer Program
Gold Business Cards Stand Out !!! Easy to locate among the others. printing is great!!!!
Reviews for similar products
5 out of 5 stars rating
By Amy W.May 14, 2025Verified Purchase
Business Card, Size: Square, 2.5" x 2.5",Paper: Premium Pearl, Corners: Rounded
Absolutely love it. And I've never found a design even close to this that fits the aesthetic of my small candle shop! .
5 out of 5 stars rating
By Kimberly W.March 27, 2023Verified Purchase
Business Card, Size: Square, 2.5" x 2.5",Paper: Standard Semi-Gloss, Corners: Rounded
Zazzle Reviewer Program
These were used for earring cards for my small business and were absolutely amazing. The quality is superb. Very beautiful and gave my product a professional look.

Why Shop on Zazzle

  • why zazzle
  • why zazzle

Tags

Business Cards
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 240912045309499135
Created on: 4/25/2010, 1:11 PM
Rating: G