Tap / click on image to see more RealViewsTM
Sale Price $8.19.  
Original Price $9.10 Comp. value
per keychain
You save 10%

Caduceus Keychain

Qty:
Aluminum Circle
+$2.40
+$2.40
+$11.65
+$11.65

Other designs from this category

The Zazzle Promise

  • Order with Confidence

    If something goes wrong on our end, we'll make it right, on every order. Learn more!

  • FREE Shipping

    Enjoy FREE shipping with a 30-day free trial of Zazzle Plus – Learn More!

  • Secure Shopping Guaranteed

    100% Secure payment with SSL Encryption.

About Keychains

Sold by

Style: Metal Circle Keychain

Keep your keys safe and spectacular with this sturdy aluminum keychain from Zazzle. Beautifully printed on both sides, you can choose from thousands of designs, or personalize it with your own photos, text or unique designs. Label your car keys or keep a family photo of loved ones close to you at all times, these personalized keychains are light and waterproof.

  • Dimensions:
    • Diameter: 2"
    • Depth: 0.045"
    • Weight: 0.05 oz.
  • Full-color, full-bleed printing
  • Silver colored metal key ring with plastic snap ring
  • Light and waterproof
Designer Tip: To ensure the highest quality print, please note that this product’s customizable design area measures 2” in diameter. For best results please add 1/16" bleed

About This Design

Caduceus Keychain

Caduceus Keychain

Design that makes caduceus motif

Customer Reviews

4.6 out of 5 stars rating5.4K Total Reviews
4210 total 5-star reviews783 total 4-star reviews216 total 3-star reviews117 total 2-star reviews102 total 1-star reviews
5,428 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Ali Y.February 4, 2026Verified Purchase
Aluminum Circle, 2"
Lovely & cute keychains i love them thank you sooo much ,they also reached to me soo fast 😍.
5.0 out of 5 stars rating
5 out of 5 stars rating
By V.August 21, 2023Verified Purchase
Zazzle Reviewer Program
Beyond expectations. Choice of artwork is overwhelming, I found exactly what I needed from SJW_Graphics. Detail, colors, overall design looks great on this keyring. Could use as a pendant, purse charm, bookmark, too! Metal is sturdy without being heavy. Colors beautiful, with clear margins. Customized name makes this gift extra special. So many fonts, so many colors & sizes!
Original product
5.0 out of 5 stars rating
5 out of 5 stars rating
By Nico S.February 27, 2024Verified Purchase
Aluminum Circle, 2"
Zazzle Reviewer Program
I find this very interesting and great since I am a huge fan of snakes. This keychain fits the bill!

Tags

Keychains
caduceusmedicalsymbolmedicinegreekphysicianswandhermes
All Products
caduceusmedicalsymbolmedicinegreekphysicianswandhermes

Other Info

Product ID: 146613818880137283
Created on: 4/25/2010, 1:42 PM
Rating: G