Tap / click on image to see more RealViewsTM
Sale Price $15.60.  
Original Price $19.50 Comp. value
per pack of 50
You save 20% ends today

Cherries Business Cards

4.7 out of 5 stars rating
39787 Total Reviews
|
by
Qty:
Squared
+$5.35
Signature UV Matte

18 pt thickness / 325 GSM
Bright white, matte finish

-$4.50
-$4.50
+$4.45
+$4.45
+$4.45
+$4.45
+$4.45
+$4.45
+$12.40

Other designs from this category

About Business Cards

Sold by

Size: Standard, 3.5" x 2.0"

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 3.5" x 2.0"
  • Full color CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust color and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection
  • Made and printed in the USA

About This Design

Cherries Business Cards

Cherries Business Cards

designed by marlodeedesigns.com © 2004-2012 MarloDee Designs: All rights reserved. All necessary licenses have been purchased and are on file. Images on this site are NOT public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing. You may NOT use them to decorate your website with or create additional products for your business. You MUST contact me for details, information or requests to use images on your business cards. Purchasing business cards here does not give you automatic permissiion to use the image on other items - nor - does it give you exclusive rights or usage rights.

Customer Reviews

4.7 out of 5 stars rating39.8K Total Reviews
33012 total 5-star reviews3848 total 4-star reviews1077 total 3-star reviews693 total 2-star reviews1157 total 1-star reviews
39,787 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Amy W.May 14, 2025Verified Purchase
Business Cards Pack of 50, Size: Square, 2.5" x 2.5",Paper: Premium Pearl, Corners: Rounded
Absolutely love it. And I've never found a design even close to this that fits the aesthetic of my small candle shop! .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Matty W.January 5, 2021Verified Purchase
Business Cards Pack of 50, Size: Standard, 3.5" x 2.0",Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
I love to surprise my wife with notes. I make these so I can keep them in my wallet and place them anywhere when I feel she needs a little surprise. I usually hide them somewhere for her to find in her pocket or in her car to brighten her morning before work. This is my 8th or so iteration after a few years of making them and these are my favorite. The printing turned out perfect and spot on. Sometimes the cutting can be ever so slightly off but this time it was perfect. Just make sure to follow the guide and use references that have some grace space on the edges. That is key.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kimberly W.March 27, 2023Verified Purchase
Business Cards Pack of 50, Size: Square, 2.5" x 2.5",Paper: Standard Semi-Gloss, Corners: Rounded
Zazzle Reviewer Program
These were used for earring cards for my small business and were absolutely amazing. The quality is superb. Very beautiful and gave my product a professional look.

Why Shop on Zazzle

  • why zazzle
  • why zazzle

Tags

Business Cards
cherrycherriesfruitfoodcookingkitchenwhimiscalprettychicbusiness
All Products
cherrycherriesfruitfoodcookingkitchenwhimiscalprettychicbusiness

Other Info

Product ID: 240439096599212623
Created on: 3/24/2008, 5:47 PM
Rating: G