Tap / click on image to see more RealViewsTM
Sale Price $9.66.  
Original Price $16.10 Comp. value
per pack of 50
You save 40%

Cherries Business Cards

Qty:
Squared
+$5.35
Signature UV Matte

18 pt thickness / 325 GSM
Bright white, matte finish

-$4.50
-$4.50
+$4.45
+$4.45
+$4.45
+$4.45
+$4.45
+$4.45
+$12.40

Other designs from this category

About Business Cards

Sold by

Size: Standard, 3.5" x 2.0"

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 3.5" x 2.0"
  • Full color CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust color and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection
  • Made and printed in the USA

About This Design

Cherries Business Cards

Cherries Business Cards

designed by marlodeedesigns.com © 2004-2012 MarloDee Designs: All rights reserved. All necessary licenses have been purchased and are on file. Images on this site are NOT public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing. You may NOT use them to decorate your website with or create additional products for your business. You MUST contact me for details, information or requests to use images on your business cards. Purchasing business cards here does not give you automatic permissiion to use the image on other items - nor - does it give you exclusive rights or usage rights.

Customer Reviews

4.7 out of 5 stars rating39.2K Total Reviews
32616 total 5-star reviews3822 total 4-star reviews1032 total 3-star reviews658 total 2-star reviews1027 total 1-star reviews
39,155 Reviews
Reviews for similar products
5 out of 5 stars rating
By Amy W.May 14, 2025Verified Purchase
Business Cards Pack of 50, Size: Square, 2.5" x 2.5",Paper: Premium Pearl, Corners: Rounded
Absolutely love it. And I've never found a design even close to this that fits the aesthetic of my small candle shop! .
5 out of 5 stars rating
By Kimberly W.March 27, 2023Verified Purchase
Business Cards Pack of 50, Size: Square, 2.5" x 2.5",Paper: Standard Semi-Gloss, Corners: Rounded
Zazzle Reviewer Program
These were used for earring cards for my small business and were absolutely amazing. The quality is superb. Very beautiful and gave my product a professional look.
5 out of 5 stars rating
By Gisselle A.April 2, 2026Verified Purchase
Business Cards Pack of 50, Size: Standard, 3.5" x 2.0",Paper: Premium Silk, Corners: Rounded
Beautiful job on my print, I have actually received a lot of compliments on my design. Will be ordering more!!! 🌟 if you are reading this I highly recommend 💛 .

Why Shop on Zazzle

  • why zazzle
  • why zazzle

Tags

Business Cards
cherrycherriesfruitfoodcookingkitchenwhimiscalprettychicbusiness
All Products
cherrycherriesfruitfoodcookingkitchenwhimiscalprettychicbusiness

Other Info

Product ID: 240439096599212623
Created on: 3/24/2008, 5:47 PM
Rating: G