Tap / click on image to see more RealViewsTM
Sale Price $20.96.  
Original Price $26.20 Comp. value
per pack of 100
You save 20% ends today

Farmers Market Organic Fresh Eggs Chicken Business Card

Qty:
Squared
+$5.35
Signature Matte

18 pt thickness / 120 lb weight
Light eggshell white, uncoated matte finish

+$5.05
+$5.05
+$5.05
+$10.10
+$10.10
+$10.10
+$10.10
+$10.10
+$10.10
+$19.15

Other designs from this category

Shop this collection

Dhouha Zarria
Fresh Eggs Collection Designed by Dhouha Zarria
Tap / click on image to see more RealViewsTM
 
 
 
 
 
 
 
 

About Business Cards

Sold by

Size: Standard, 3.5" x 2.0"

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 3.5" x 2.0"
  • Full color CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature Matte

Signature Matte is our best-selling paper—timeless, elegant, and crafted for a premium feel. With its softly textured, uncoated matte finish and sturdy 18 point thickness, it delivers a refined look and lasting impression. Made exclusively for Zazzle by Neenah, it blends print clarity, sustainability, and elevated style.

  • Light white, uncoated matte finish with an eggshell texture
  • Thick, premium-quality stock with a substantial feel (18 pt)
  • Ideal for writing—won't smudge or smear
  • Made with 30% post-consumer waste
  • Made and printed in the USA

About This Design

Farmers Market Organic Fresh Eggs Chicken  Business Card

Farmers Market Organic Fresh Eggs Chicken Business Card

Make a lasting impression with this clean and professional business card. Perfect for your farmers market stall, it highlights the quality and freshness of your organic eggs. Featuring a sleek design with a charming chicken motif, it’s an excellent way to promote your farm business and connect with customers.

Customer Reviews

4.7 out of 5 stars rating38.1K Total Reviews
31958 total 5-star reviews3781 total 4-star reviews945 total 3-star reviews568 total 2-star reviews834 total 1-star reviews
38,086 Reviews
Reviews for similar products
5 out of 5 stars rating
By Amy W.May 14, 2025Verified Purchase
Business Card, Size: Square, 2.5" x 2.5",Paper: Premium Pearl, Corners: Rounded
Absolutely love it. And I've never found a design even close to this that fits the aesthetic of my small candle shop! .
5 out of 5 stars rating
By Kimberly W.March 27, 2023Verified Purchase
Business Card, Size: Square, 2.5" x 2.5",Paper: Standard Semi-Gloss, Corners: Rounded
Zazzle Reviewer Program
These were used for earring cards for my small business and were absolutely amazing. The quality is superb. Very beautiful and gave my product a professional look.
5 out of 5 stars rating
By Jeremiah T.July 8, 2025Verified Purchase
Business Card, Size: Standard, 3.5" x 2.0",Paper: Signature Matte, Corners: Squared
These business cards came out perfectly. Thank you guys for the great work at a great price! .

Why Shop on Zazzle

  • why zazzle
  • why zazzle

Tags

Business Cards
farmers marketrusticcountryfarmhousechickenfarmvintagechickensfamily farmegg business cards
All Products
farmers marketrusticcountryfarmhousechickenfarmvintagechickensfamily farmegg business cards

Other Info

Product ID: 256877951835633484
Created on: 6/21/2024, 1:10 PM
Rating: G