Tap / click on image to see more RealViewsTM
Sale Price $22.12.  
Original Price $27.65 Comp. value
per pack of 100
You save 20%

Kids Playing Business Card

Qty:
Squared
+$5.35
Signature UV Matte

18 pt thickness / 325 GSM
Bright white, matte finish

-$4.50
-$4.50
+$4.45
+$4.45
+$4.45
+$4.45
+$4.45
+$4.45
+$12.40

Other designs from this category

About Business Cards

Sold by

Size: Standard, 3.5" x 2.0"

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 3.5" x 2.0"
  • Full color CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust color and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection
  • Made and printed in the USA

About This Design

Kids Playing Business Card

Kids Playing Business Card

designed by marlodeedesigns.com © 2004-2012 MarloDee Designs: All rights reserved. All necessary licenses have been purchased and are on file. Images on this site are NOT public domain. You may not copy, duplicate, alter or scan these designs, images, illustrations, photography, art and writing. You may NOT use them to decorate your website with or create additional products for your business. You MUST contact me for details, information or requests to use images on your business cards. Purchasing business cards here does not give you automatic permissiion to use the image on other items - nor - does it give you exclusive rights or usage rights.

Customer Reviews

4.7 out of 5 stars rating38.8K Total Reviews
32422 total 5-star reviews3809 total 4-star reviews1005 total 3-star reviews630 total 2-star reviews973 total 1-star reviews
38,839 Reviews
Reviews for similar products
5 out of 5 stars rating
By Amy W.May 14, 2025Verified Purchase
Business Card, Size: Square, 2.5" x 2.5",Paper: Premium Pearl, Corners: Rounded
Absolutely love it. And I've never found a design even close to this that fits the aesthetic of my small candle shop! .
5 out of 5 stars rating
By Kimberly W.March 27, 2023Verified Purchase
Business Card, Size: Square, 2.5" x 2.5",Paper: Standard Semi-Gloss, Corners: Rounded
Zazzle Reviewer Program
These were used for earring cards for my small business and were absolutely amazing. The quality is superb. Very beautiful and gave my product a professional look.
5 out of 5 stars rating
By Jeremiah T.July 8, 2025Verified Purchase
Business Card, Size: Standard, 3.5" x 2.0",Paper: Signature Matte, Corners: Squared
These business cards came out perfectly. Thank you guys for the great work at a great price! .

Why Shop on Zazzle

  • why zazzle
  • why zazzle

Tags

Business Cards
childrenkidskidplayingwhimiscaldoodlecutebusiness
All Products
childrenkidskidplayingwhimiscaldoodlecutebusiness

Other Info

Product ID: 240020705539831869
Created on: 3/30/2008, 8:15 AM
Rating: G