Tap / click on image to see more RealViewsTM
Sale Price $9.05.  
Original Price $10.05 Comp. value
per sticker
You save 10%

Peacocks' feather Rangoli on pattern Sticker

4.5 out of 5 stars rating
1118 Total Reviews
|
by
Qty:

Other designs from this category

About Custom-Cut Vinyl Stickers

Sold by

Sticker Sheet Size: 8" x 8" Sheet

Design your own custom contour kiss-cut vinyl stickers. Upload one design for a single standout sticker, or add up to 30 different designs per sheet. Each sticker is individually kiss-cut with precision laser technology to match the exact shape of your artwork, giving you that clean die-cut look on an easy-peel vinyl sheet.

  • Sheet Size: 8" L x 8.5" W
  • Design Area: 8" L x 8" W
  • Up to 30 contour-cut stickers per sheet
  • Each sticker is cut to the exact shape of your image
  • Removable, low-tack adhesive that peels clean with no residue
  • Available in matte white, glossy white, or glossy transparent vinyl
  • Printed with solvent inks: fade-proof, waterproof, and scratch-resistant
  • Available in 6 sizes
  • A 0.125" border is added around each sticker to protect your design and help it pop on any surface
⚠️ WARNING! Choking hazard. Small parts. Not for children under 3 years.

About This Design

Peacocks' feather Rangoli on pattern Sticker

Peacocks' feather Rangoli on pattern Sticker

Beautiful design with peacocks' feathers Rangoli. Colourful Rangoli is traditionally drawn with the fingers using flour, rice grains or coloured chalk. At Diwali, Hindus draw bright Rangoli patterns to encourage the goddess Lakshmi to enter their homes. This awesome Rangoli is made of peacocks' feathers and little Diya lamp in the middle. Pattern behind the Rangoli: single peacock's feather with little Diya lamps on crimson red background. Let's decorate your HOME with this beautiful design. Happy Diwali!

Customer Reviews

4.5 out of 5 stars rating1.1K Total Reviews
902 total 5-star reviews67 total 4-star reviews27 total 3-star reviews32 total 2-star reviews90 total 1-star reviews
1,118 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Aurelia T.May 5, 2022Verified Purchase
14" x 14" Sheet Custom-Cut Vinyl Stickers, Matte White
Zazzle Reviewer Program
I was able to give us a designer the dimensions of my mini shot glasses and she was able to reduce all the labels onto one sheet we’re all I did was going to change the names and add the table number for my seating chart absolutely perfect. Simple perfect easy to read fit great on my jar
5.0 out of 5 stars rating
5 out of 5 stars rating
By Charmtastic M.December 17, 2024Verified Purchase
The Dunkadelic-Dunkman Vinyl Stickers are amazing in quality and printing of the logo. Zazzle is always 5-stars with their products for The "Charm'tastic Mile" of Baltimore.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Debra S.July 10, 2024Verified Purchase
3" x 3" Sheet Custom-Cut Vinyl Stickers, Matte White
A+ Love these stickers! All my friends know if this sticker is on something it belongs to me. They are great quality. They don’t peel and are water resistant. I give them away as gifts and they are grilled to receive. Printing is first class! Colors are beautiful and don’t fade or peel. The design is nice on the eyes and decorate all kinds of things.

Tags

Custom-Cut Vinyl Stickers
happy diwalidiyadiwalideepavalidiyasfestival of lightspeacockhinduhindu occasionhappy deepavali
All Products
happy diwalidiyadiwalideepavalidiyasfestival of lightspeacockhinduhindu occasionhappy deepavali

Other Info

Product ID: 256270527174070756
Created on: 3/22/2023, 8:30 AM
Rating: G