Tap / click on image to see more RealViewsTM
The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
Sale Price $20.44.  
Original Price $29.20 Comp. value
per pack of 100
You save 30%

Personalized Gold Shiny Heart Glitter Vip Business Card

Qty:
Squared
+$5.35
Signature UV Matte

18 pt thickness / 325 GSM
Bright white, matte finish

-$4.75
-$4.75
+$4.70
+$4.70
+$4.70
+$4.70
+$4.70
+$4.70
+$13.10

Other designs from this category

About Business Cards

Sold by

Size: Standard, 3.5" x 2.0"

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 3.5" x 2.0"
  • Full color CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Signature UV Matte

An upgrade from our Standard Matte, Signature UV Matte features a thicker and stiffer paper coated with a protective finish. It provides the perfect base for creating long-lasting, high-quality designs with robust color and detail.

  • 18 pt thickness/ 325 GSM
  • Bright white, matte finish
  • UV coating adds an additional layer of protection
  • Made and printed in the USA

About This Design

The glitter details are simulated in the artwork. No actual glitter will be used in the making of this product.
Personalized Gold Shiny Heart Glitter Vip Business Card

Personalized Gold Shiny Heart Glitter Vip Business Card

Make a dazzling impression with the "Personalized Gold Shiny Heart Glitter VIP Business Card," designed to reflect the utmost elegance and exclusivity. This business card is ideal for professionals in the beauty, fashion, or luxury service industries who wish to communicate a sense of sophistication and VIP status to every interaction. The card features a luxurious gold background embellished with a subtle glitter effect, creating a shimmering canvas that catches the light and eyes alike. Central to the design is a shiny heart symbol, representing passion and care in your professional engagements. This heart motif is not only stylish but also conveys a message of love and dedication to your craft or service. Personalization is at the forefront of this design. You can customize the card with your name, title, and contact details, showcased in an elegant font that complements the card's opulent theme. The layout is meticulously crafted to balance aesthetics and readability, ensuring that your essential information is both prominent and beautiful. Printed on high-quality cardstock, these business cards have a glossy finish that enhances the golden hues and glitter, making each handover feel significant and exclusive. The premium material and print quality ensure that the card withstands the test of time and handling, embodying the durability and permanence of your professional relationships. Ideal for networking events, client meetings, or as a daily reminder of your professional image, the "Personalized Gold Shiny Heart Glitter VIP Business Card" is more than just a tool for sharing contact information—it's a statement of your commitment to excellence and luxury. #LuxuryBranding #ElegantNetworking #VIPExperience ✨💖👑

Customer Reviews

4.7 out of 5 stars rating38.1K Total Reviews
31971 total 5-star reviews3781 total 4-star reviews947 total 3-star reviews569 total 2-star reviews836 total 1-star reviews
38,104 Reviews
Reviews for similar products
5 out of 5 stars rating
By Amy W.May 14, 2025Verified Purchase
Business Card, Size: Square, 2.5" x 2.5",Paper: Premium Pearl, Corners: Rounded
Absolutely love it. And I've never found a design even close to this that fits the aesthetic of my small candle shop! .
5 out of 5 stars rating
By Kimberly W.March 27, 2023Verified Purchase
Business Card, Size: Square, 2.5" x 2.5",Paper: Standard Semi-Gloss, Corners: Rounded
Zazzle Reviewer Program
These were used for earring cards for my small business and were absolutely amazing. The quality is superb. Very beautiful and gave my product a professional look.
5 out of 5 stars rating
By Jeremiah T.July 8, 2025Verified Purchase
Business Card, Size: Standard, 3.5" x 2.0",Paper: Signature Matte, Corners: Squared
These business cards came out perfectly. Thank you guys for the great work at a great price! .

Why Shop on Zazzle

  • why zazzle
  • why zazzle

Tags

Business Cards
goldglampeachpinkshinyvipglitterbeautystylistmake
All Products
goldglampeachpinkshinyvipglitterbeautystylistmake

Other Info

Product ID: 240958605074950049
Created on: 4/27/2016, 9:48 AM
Rating: G