Tap / click on image to see more RealViewsTM
The foil details are simulated in the artwork. No actual foil will be used in the making of this product.
Sale Price $13.88.  
Original Price $17.35 Comp. value
per pack of 50
You save 20%

Silver Frame / Cursive Typography Mini Business Card

Qty:
Standard Semi-Gloss

16 pt thickness / 150 lb weight
Bright white, semi-gloss finish

+$6.80
+$6.80
+$6.80
+$13.50
+$13.50
+$13.50
+$13.50
+$13.50
+$13.50

Other designs from this category

About Business Cards

Sold by

Size: Mini, 3.0" x 1.0"

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 3.0" x 1.0"
  • Full color CMYK print process
  • Double sided printing for no additional cost

Paper: Standard Semi-Gloss

Our most versatile and economical paper, Standard Semi-Gloss produces crisp, vibrant images with exceptional color and detail—a solid choice for all your printing needs.

  • 16 pt thickness / 150 lb weight / 400 GSM
  • Bright white, semi-gloss finish
  • 50% recycled content
  • Paper imported from Italy; printed in the USA

About This Design

The foil details are simulated in the artwork. No actual foil will be used in the making of this product.
Silver Frame / Cursive Typography Mini Business Card

Silver Frame / Cursive Typography Mini Business Card

Add your text and company information on these template ready business cards. Recommended best on a heavy stock paper for higher print quality and more protective substrate. For any design requests contact the designer. ©2010 Joshua Martin

Customer Reviews

4.7 out of 5 stars rating40.3K Total Reviews
33315 total 5-star reviews3874 total 4-star reviews1097 total 3-star reviews728 total 2-star reviews1246 total 1-star reviews
40,260 Reviews
Reviews for similar products
5.0 out of 5 stars rating
5 out of 5 stars rating
By Amy W.May 14, 2025Verified Purchase
Business Cards Pack of 50, Size: Square, 2.5" x 2.5",Paper: Premium Pearl, Corners: Rounded
Absolutely love it. And I've never found a design even close to this that fits the aesthetic of my small candle shop! .
5.0 out of 5 stars rating
5 out of 5 stars rating
By Matty W.January 5, 2021Verified Purchase
Business Cards Pack of 50, Size: Standard, 3.5" x 2.0",Paper: Signature Matte, Corners: Squared
Zazzle Reviewer Program
I love to surprise my wife with notes. I make these so I can keep them in my wallet and place them anywhere when I feel she needs a little surprise. I usually hide them somewhere for her to find in her pocket or in her car to brighten her morning before work. This is my 8th or so iteration after a few years of making them and these are my favorite. The printing turned out perfect and spot on. Sometimes the cutting can be ever so slightly off but this time it was perfect. Just make sure to follow the guide and use references that have some grace space on the edges. That is key.
5.0 out of 5 stars rating
5 out of 5 stars rating
By Kimberly W.March 27, 2023Verified Purchase
Business Cards Pack of 50, Size: Square, 2.5" x 2.5",Paper: Standard Semi-Gloss, Corners: Rounded
Zazzle Reviewer Program
These were used for earring cards for my small business and were absolutely amazing. The quality is superb. Very beautiful and gave my product a professional look.

NEW! Premium Business Cards

Foil. Spot UV. Plastic. Find the finish that fits your brand.

Shop Now

Why Shop on Zazzle

  • why zazzle
  • why zazzle

Tags

Business Cards
fashion designerminimalistsimpleelegantlawyerfashion bloggerboutiqueuniquesilver foilfinance
All Products
fashion designerminimalistsimpleelegantlawyerfashion bloggerboutiqueuniquesilver foilfinance

Other Info

Product ID: 240010312512147661
Created on: 12/16/2017, 11:55 PM
Rating: G