Tap / click on image to see more RealViewsTM
The foil details are simulated in the artwork. No actual foil will be used in the making of this product.
Sale Price $18.80.  
Original Price $26.85 Comp. value
per pack of 100
You save 30%

Silver Frame / Cursive Typography Mini Business Card

Qty:
Standard Semi-Gloss

16 pt thickness / 150 lb weight
Bright white, semi-gloss finish

+$2.70
+$2.70
+$2.70
+$5.40
+$5.40
+$5.40
+$5.40
+$5.40
+$5.40

Other designs from this category

About Business Cards

Sold by

Size: Mini, 3.0" x 1.0"

When it comes to your business, don't wait for opportunity, create it! Make a lasting impression with quality cards that WOW.

  • Dimensions: 3.0" x 1.0"
  • Full color CMYK print process
  • Double sided printing for no additional cost
  • 100% satisfaction guarantee

Paper: Standard Semi-Gloss

Our most versatile and economical paper, Standard Semi-Gloss produces crisp, vibrant images with exceptional color and detail—a solid choice for all your printing needs.

  • 16 pt thickness / 150 lb weight / 400 GSM
  • Bright white, semi-gloss finish
  • 50% recycled content
  • Paper imported from Italy; printed in the USA

About This Design

The foil details are simulated in the artwork. No actual foil will be used in the making of this product.
Silver Frame / Cursive Typography Mini Business Card

Silver Frame / Cursive Typography Mini Business Card

Add your text and company information on these template ready business cards. Recommended best on a heavy stock paper for higher print quality and more protective substrate. For any design requests contact the designer. ©2010 Joshua Martin

Customer Reviews

4.7 out of 5 stars rating38.1K Total Reviews
31958 total 5-star reviews3781 total 4-star reviews945 total 3-star reviews568 total 2-star reviews832 total 1-star reviews
38,084 Reviews
Reviews for similar products
5 out of 5 stars rating
By Amy W.May 14, 2025Verified Purchase
Business Card, Size: Square, 2.5" x 2.5",Paper: Premium Pearl, Corners: Rounded
Absolutely love it. And I've never found a design even close to this that fits the aesthetic of my small candle shop! .
5 out of 5 stars rating
By Kimberly W.March 27, 2023Verified Purchase
Business Card, Size: Square, 2.5" x 2.5",Paper: Standard Semi-Gloss, Corners: Rounded
Zazzle Reviewer Program
These were used for earring cards for my small business and were absolutely amazing. The quality is superb. Very beautiful and gave my product a professional look.
5 out of 5 stars rating
By Jeremiah T.July 8, 2025Verified Purchase
Business Card, Size: Standard, 3.5" x 2.0",Paper: Signature Matte, Corners: Squared
These business cards came out perfectly. Thank you guys for the great work at a great price! .

Why Shop on Zazzle

  • why zazzle
  • why zazzle

Tags

Business Cards
fashion designerminimalistsimpleelegantlawyerfashion bloggerboutiqueuniquesilver foilfinance
All Products
fashion designerminimalistsimpleelegantlawyerfashion bloggerboutiqueuniquesilver foilfinance

Other Info

Product ID: 240010312512147661
Created on: 12/16/2017, 11:55 PM
Rating: G