Viking Pattern Blue (Front)Viking Pattern Blue (Standing Front)Viking Pattern Blue (Front/Back)
Viking Pattern Blue (Back)
Sale Price $2.27.  
Original Price $3.23 Comp. value
per card
You save 30%

Viking Pattern Blue

4.8 out of 5 stars rating
2233 Total Reviews
| by ArtYourself
View Product Details

Popular from this Department

About Flat Cards

Sold by

Size: 3.5" x 5"

Stand out with custom flat cards, turn this flat card into anything imaginable.

  • Dimensions: 3.5" x 5" (portrait or landscape)
  • High-quality, full-color, full-bleed printing
  • Print on both sides for no additional cost
  • Add personal photos and text for free

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Viking Pattern Blue

Viking Pattern Blue

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.8 out of 5 stars rating2.2K Total Reviews
1960 total 5-star reviews153 total 4-star reviews32 total 3-star reviews22 total 2-star reviews66 total 1-star reviews
2,233 Reviews
Reviews for similar products
5 out of 5 stars rating
By Margo O.August 8, 2024Verified Purchase
Flat Card, Size: 5.25" x 5.25", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Creator Review
When I received these Save-the-date card, I was excited see how pretty it is. Elegant floral wedding design. The print came out perfect.
5 out of 5 stars rating
By Sabrina J.September 12, 2025Verified Purchase
Flat Card, Size: 3.5" x 5", Paper: Signature Matte, Corner: Squared, Envelopes: White, Print Quality: Standard
Great quality product. Not thin or flimsy at all !! Super fast production and super fast ship even without rush shipping. Great seller. Definitely ordering more items ! .
5 out of 5 stars rating
By G.November 24, 2019Verified Purchase
Flat Card, Size: 8" x 4", Paper: Basic Semi-Gloss, Corner: Squared, Envelopes: White, Print Quality: Standard
Zazzle Reviewer Program
The cards were perfect, the quality and durability couldn't be any better. I have an envelope size which is glossy and a pearlized business card size which is slightly wider than a business card. The timing received was perfect although a bit costly, not do to zazzles fault. When I originally designed this product, Imade an error in the original photo and they red flagged it for me and emailed me about it. They immediately responded to my questions about it, understood and immediately gave me a refund. Very polite kind customer service. The printing came out perfect.

Tags

Flat Cards
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256091188921896013
Created on: 11/17/2017, 10:18 PM
Rating: G