Viking Pattern Blue (Front)Viking Pattern Blue (Back)Viking Pattern Blue (Standing Front)
Viking Pattern Blue (Front/Back)
Sale Price $2.12.  
Original Price $3.02 Comp. value
per card
You save 30%

Viking Pattern Blue

4.7 out of 5 stars rating
2262 Total Reviews
| by ArtYourself
View Product Details

Popular from this Department

About Flat Cards

Sold by

Size: 3.5" x 5"

Stand out with custom flat cards, turn this flat card into anything imaginable.

  • Dimensions: 3.5" x 5" (portrait or landscape)
  • High-quality, full-color, full-bleed printing
  • Print on both sides for no additional cost
  • Add personal photos and text for free

Paper Type: Signature Matte

Our Signature Matte paper is a customer favorite—smooth to the touch with a soft eggshell texture that elevates any design. Its sturdy 18 pt weight and natural feel make it the ideal choice for timeless, sophisticated events.

  • Exclusively made for Zazzle
  • Made and Printed in the USA
  • FSC® Certified—sourced from responsibly managed forests that protect both people and planet

About This Design

Viking Pattern Blue

Viking Pattern Blue

Viking pattern blue is a scroll design. White scroll filigree is a modern seamless motif tattoo

Customer Reviews

4.7 out of 5 stars rating2.3K Total Reviews
1982 total 5-star reviews153 total 4-star reviews34 total 3-star reviews23 total 2-star reviews70 total 1-star reviews
2,262 Reviews
Reviews for similar products
5 out of 5 stars rating
By Margo O.August 8, 2024Verified Purchase
Flat Card, Size: 5.25" x 5.25", Paper: Signature Matte, Corner: Squared, Envelopes: Blank White Envelopes, Print Quality: Standard
Creator Review
When I received these Save-the-date card, I was excited see how pretty it is. Elegant floral wedding design. The print came out perfect.
5 out of 5 stars rating
By Sabrina J.September 12, 2025Verified Purchase
Flat Card, Size: 3.5" x 5", Paper: Signature Matte, Corner: Squared, Envelopes: Blank White Envelopes, Print Quality: Standard
Great quality product. Not thin or flimsy at all !! Super fast production and super fast ship even without rush shipping. Great seller. Definitely ordering more items ! .
5 out of 5 stars rating
By Suzi G.December 10, 2025Verified Purchase
Flat Card, Size: 4.25" x 5.5", Paper: Signature Matte, Corner: Squared, Envelopes: Blank White Envelopes, Print Quality: Standard
I'm so excited for my Mom to get this Card!!! Thank you to the Creator for these beautiful lilies, they're so pretty! Moms favorite flower 🤗👍.

Tags

Flat Cards
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior
All Products
scrollseamlessneo nordic scroll motifsweaterarticnorwegianpatternfiligreevikingwarrior

Other Info

Product ID: 256091188921896013
Created on: 11/17/2017, 10:18 PM
Rating: G