Sell on Zazzle
Tap / click on image to see more RealViewsTM
Sale Price $42.46.  
Original Price $49.95 Comp. value
per wallpaper roll
You save 15%

wallpaper

4.0 out of 5 stars rating
6 Total Reviews |
by
Qty:

Other designs from this category

About Wallpapers

Sold by
Wallpaper
Create your own from scratch

Style: Textured vinyl

Introducing our Peel and Stick Wallpaper, a game-changer for effortless room transformations. This high-quality wallpaper features a matte finish and a hassle-free peel-and-stick application, making it a breeze to revamp your living spaces. Choose from textured vinyl or smooth vinyl and six different sizes, including a swatch so you can test the application, and find that perfect fit, ranging from small accent walls to large room makeovers.

  • Easy Maintenance: The wallpaper's smooth surface allows for easy cleaning and maintenance, making it perfect for busy households or high-traffic areas.
  • Residue-free Removal: When it's time for a change, our wallpaper can be easily removed without leaving any residue or damaging your walls, allowing for a hassle-free transition.
  • Versatile Design Options: Choose from a wide range of captivating designs, patterns, and colors to suit your personal style and enhance the ambiance of any room.
  • DIY-Friendly: Our Peel and Stick Wallpaper is designed for easy DIY installation, making it accessible to anyone. No professional skills or tools are required, saving you time and money.
  • Need some help hanging your wallpaper? Please check out our how-to guide here

About This Design

wallpaper

wallpaper

Transform Your Space with Peel and Stick Wallpaper Elevate your living spaces effortlessly with our Peel and Stick Wallpaper. This innovative product features a high-quality matte finish and a simple peel-and-stick application, allowing you to transform any room with ease. Choose from textured vinyl or smooth vinyl and six different sizes, including a handy swatch to test the application. Whether you’re looking to accent a small wall or give an entire room a makeover, our wallpaper is the perfect fit. Key Features: Easy Maintenance: The wallpaper's smooth surface ensures easy cleaning and maintenance, ideal for busy households or high-traffic areas. Residue-free Removal: When it's time for a change, our wallpaper can be removed effortlessly without leaving any residue or damaging your walls, ensuring a seamless transition. Versatile Design Options: Explore a wide range of captivating designs, patterns, and colors to match your personal style and enhance any room's ambiance. DIY-Friendly: Designed for easy DIY installation, our Peel and Stick Wallpaper requires no professional skills or tools, saving you time and money.
ZazleLover
Artwork designed by
petersburgh, Florida
View their Store

Customer Reviews

4.0 out of 5 stars rating6 Total Reviews
4 total 5-star reviews0 total 4-star reviews1 total 3-star reviews0 total 2-star reviews1 total 1-star reviews
6 Reviews
Reviews for similar products
5 out of 5 stars rating
By Charles K.August 15, 2025 • Verified Purchase
Custom Wallpaper 2' x 4', Textured vinyl
It is fabulous! Am always excited to show others. It is dramatic!!
5 out of 5 stars rating
By Suzanne R.September 18, 2025 • Verified Purchase
Custom Wallpaper 2' x 4', Textured vinyl
Great xxxxxxxccc. Yuyyyyyyyyyyyyyyyyyy.
3 out of 5 stars rating
By Naomi J.July 3, 2025 • Verified Purchase
Custom Wallpaper 2' x 4', Textured vinyl
Need a lot to complete a small space because the lobster is all have to line up perfectly from peace to peace. I’ve already spent $600 and I need to order two more rolls in order to cover a very small space the size of a closet. The product has nice quality however the price is a little unreasonable for the sizes that they offer. I still will have to buy three more rolls that will make this almost $1000 project.

Tags

Wallpapers
wallpaperpeelstickmattevinyltexturedsmootheasydiymaintenance
All Products
wallpaperpeelstickmattevinyltexturedsmootheasydiymaintenance

Other Info

Product ID: 256759750967735754
Created on: 8/6/2024, 9:54 AM
Rating: G 
Related Searches
wallpaperwallpaperremovable wallpaper